Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LKM8

Protein Details
Accession A0A4Q9LKM8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
72-97QNNAEREIRQEKKRERRRIVTCLTDPHydrophilic
NLS Segment(s)
PositionSequence
82-88EKKRERR
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MHPILEGNRQKVLHSILDSVTAVEQERPRSAILAVRKRFERMPRKSCSALLRYYNRKFSRTVDIDVLKKFKQNNAEREIRQEKKRERRRIVTCLTDPCSLIDNTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.22
4 0.24
5 0.23
6 0.2
7 0.16
8 0.12
9 0.11
10 0.13
11 0.16
12 0.16
13 0.17
14 0.18
15 0.18
16 0.18
17 0.18
18 0.19
19 0.26
20 0.33
21 0.34
22 0.37
23 0.38
24 0.39
25 0.43
26 0.48
27 0.49
28 0.49
29 0.54
30 0.56
31 0.6
32 0.59
33 0.59
34 0.54
35 0.48
36 0.42
37 0.41
38 0.43
39 0.45
40 0.47
41 0.52
42 0.48
43 0.46
44 0.44
45 0.4
46 0.43
47 0.38
48 0.38
49 0.34
50 0.36
51 0.37
52 0.38
53 0.38
54 0.29
55 0.29
56 0.28
57 0.27
58 0.33
59 0.38
60 0.43
61 0.47
62 0.54
63 0.51
64 0.59
65 0.64
66 0.61
67 0.6
68 0.62
69 0.65
70 0.69
71 0.79
72 0.81
73 0.81
74 0.84
75 0.86
76 0.86
77 0.83
78 0.81
79 0.76
80 0.73
81 0.68
82 0.6
83 0.52
84 0.44
85 0.4