Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9LS78

Protein Details
Accession A0A4Q9LS78    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
13-39AAKATRSSSKEKKKWSASKAKETNRRAHydrophilic
NLS Segment(s)
PositionSequence
9-34KAAKAAKATRSSSKEKKKWSASKAKE
Subcellular Location(s) nucl 16.5, cyto_nucl 12.333, mito_nucl 11.166, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MVKKIQETKAAKAAKATRSSSKEKKKWSASKAKETNRRAVCIDNELLAKIRKEIVNMNYVTKSIVSERYGLCLSLSKNLLEMFCGENLIAPVLFNSIVKVYGKVVKKEKIETPKVVEGEAWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.51
4 0.51
5 0.54
6 0.62
7 0.65
8 0.69
9 0.69
10 0.72
11 0.77
12 0.79
13 0.82
14 0.83
15 0.83
16 0.8
17 0.84
18 0.84
19 0.84
20 0.83
21 0.79
22 0.78
23 0.71
24 0.65
25 0.56
26 0.5
27 0.42
28 0.37
29 0.33
30 0.25
31 0.22
32 0.19
33 0.2
34 0.17
35 0.16
36 0.12
37 0.14
38 0.13
39 0.14
40 0.18
41 0.18
42 0.22
43 0.23
44 0.24
45 0.21
46 0.21
47 0.2
48 0.15
49 0.13
50 0.09
51 0.11
52 0.11
53 0.13
54 0.13
55 0.15
56 0.16
57 0.15
58 0.14
59 0.14
60 0.13
61 0.15
62 0.16
63 0.13
64 0.14
65 0.15
66 0.15
67 0.12
68 0.13
69 0.1
70 0.09
71 0.1
72 0.08
73 0.08
74 0.08
75 0.09
76 0.07
77 0.05
78 0.05
79 0.06
80 0.07
81 0.06
82 0.07
83 0.07
84 0.09
85 0.09
86 0.1
87 0.12
88 0.19
89 0.24
90 0.3
91 0.37
92 0.42
93 0.46
94 0.5
95 0.56
96 0.59
97 0.62
98 0.6
99 0.6
100 0.61
101 0.57
102 0.52