Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9LZ45

Protein Details
Accession A0A4Q9LZ45    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
74-98ELFAEKKGINRKKSRNKKYEDDLQDHydrophilic
NLS Segment(s)
PositionSequence
63-91YPKEEKKRTRWELFAEKKGINRKKSRNKK
126-129KKAK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MYIDLHNLVITDNDKVEEEDINSKVSKLLRTAFNLIKRIPPTGSGKDFLWEHSTKRIIHPRMYPKEEKKRTRWELFAEKKGINRKKSRNKKYEDDLQDYVPKYGKNSKKNLEKSVGIYEIKSTLKKKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.14
4 0.13
5 0.14
6 0.17
7 0.18
8 0.19
9 0.18
10 0.18
11 0.2
12 0.21
13 0.2
14 0.19
15 0.23
16 0.25
17 0.29
18 0.35
19 0.37
20 0.41
21 0.42
22 0.4
23 0.41
24 0.38
25 0.36
26 0.3
27 0.29
28 0.3
29 0.32
30 0.34
31 0.3
32 0.29
33 0.3
34 0.29
35 0.26
36 0.26
37 0.21
38 0.2
39 0.23
40 0.26
41 0.24
42 0.3
43 0.37
44 0.35
45 0.38
46 0.44
47 0.49
48 0.52
49 0.58
50 0.58
51 0.58
52 0.66
53 0.71
54 0.71
55 0.68
56 0.71
57 0.74
58 0.71
59 0.66
60 0.61
61 0.63
62 0.62
63 0.6
64 0.54
65 0.47
66 0.47
67 0.54
68 0.54
69 0.52
70 0.55
71 0.6
72 0.67
73 0.77
74 0.83
75 0.83
76 0.83
77 0.83
78 0.81
79 0.8
80 0.77
81 0.73
82 0.64
83 0.57
84 0.55
85 0.48
86 0.43
87 0.35
88 0.28
89 0.25
90 0.33
91 0.38
92 0.41
93 0.49
94 0.57
95 0.65
96 0.72
97 0.75
98 0.72
99 0.67
100 0.62
101 0.6
102 0.56
103 0.46
104 0.39
105 0.33
106 0.32
107 0.31
108 0.33
109 0.29