Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9L1H6

Protein Details
Accession A0A4Q9L1H6    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MWIRKKSRKYNKYYFYNEDTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.666, mito 11.5, nucl 10.5, cyto_nucl 7.333, cyto 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046357  PPIase_dom_sf  
IPR000297  PPIase_PpiC  
IPR001202  WW_dom  
Gene Ontology GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
Pfam View protein in Pfam  
PF00639  Rotamase  
PF00397  WW  
PROSITE View protein in PROSITE  
PS50198  PPIC_PPIASE_2  
PS50020  WW_DOMAIN_2  
CDD cd00201  WW  
Amino Acid Sequences MWIRKKSRKYNKYYFYNEDTGESIWKHPKTNFKIYHILIKHENSRKPNNDYTYEMAVEKINEIINILEENRNILDFLSFFMKIAEENSMCSSFKRGGYLGTICKNEMLKEFEDVALSLGEDEFKGPVSTDSGLHIIYRSNNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.78
3 0.72
4 0.63
5 0.54
6 0.46
7 0.37
8 0.32
9 0.26
10 0.23
11 0.27
12 0.28
13 0.29
14 0.32
15 0.42
16 0.46
17 0.55
18 0.57
19 0.54
20 0.61
21 0.58
22 0.63
23 0.54
24 0.51
25 0.45
26 0.43
27 0.46
28 0.45
29 0.49
30 0.47
31 0.54
32 0.56
33 0.57
34 0.61
35 0.57
36 0.53
37 0.51
38 0.48
39 0.42
40 0.37
41 0.31
42 0.24
43 0.2
44 0.17
45 0.13
46 0.1
47 0.08
48 0.07
49 0.07
50 0.06
51 0.06
52 0.06
53 0.07
54 0.07
55 0.06
56 0.07
57 0.07
58 0.07
59 0.07
60 0.06
61 0.05
62 0.04
63 0.06
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.08
71 0.1
72 0.07
73 0.09
74 0.11
75 0.13
76 0.13
77 0.13
78 0.15
79 0.15
80 0.16
81 0.16
82 0.15
83 0.14
84 0.18
85 0.21
86 0.23
87 0.25
88 0.25
89 0.23
90 0.26
91 0.25
92 0.23
93 0.23
94 0.22
95 0.18
96 0.2
97 0.21
98 0.19
99 0.19
100 0.18
101 0.15
102 0.11
103 0.1
104 0.07
105 0.06
106 0.06
107 0.06
108 0.06
109 0.05
110 0.06
111 0.07
112 0.07
113 0.08
114 0.11
115 0.12
116 0.12
117 0.15
118 0.15
119 0.15
120 0.15
121 0.15
122 0.15