Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9M053

Protein Details
Accession A0A4Q9M053    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
85-108GTFQNSDKNKKKKYCTCKMPSYGDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR028651  ING_fam  
IPR019786  Zinc_finger_PHD-type_CS  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR019787  Znf_PHD-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS01359  ZF_PHD_1  
PS50016  ZF_PHD_2  
CDD cd15505  PHD_ING  
Amino Acid Sequences MSKTPYETYDSILTEIQSFPLDFQHHSKKIIEIEKIYKRIKITKEISEITKKYLNIIENKMSTNGVENDNLPTLQQNISSVIKAGTFQNSDKNKKKKYCTCKMPSYGDMICCDSLECKIKWFHFECVGIVTAPKSKWYCNACKDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.16
4 0.13
5 0.12
6 0.11
7 0.15
8 0.16
9 0.17
10 0.23
11 0.32
12 0.33
13 0.36
14 0.36
15 0.35
16 0.4
17 0.44
18 0.41
19 0.36
20 0.42
21 0.47
22 0.53
23 0.51
24 0.47
25 0.44
26 0.48
27 0.47
28 0.47
29 0.45
30 0.44
31 0.49
32 0.48
33 0.5
34 0.5
35 0.47
36 0.41
37 0.41
38 0.34
39 0.3
40 0.31
41 0.3
42 0.27
43 0.3
44 0.3
45 0.28
46 0.28
47 0.27
48 0.23
49 0.2
50 0.18
51 0.15
52 0.13
53 0.12
54 0.12
55 0.12
56 0.13
57 0.12
58 0.09
59 0.08
60 0.08
61 0.08
62 0.07
63 0.07
64 0.09
65 0.1
66 0.1
67 0.1
68 0.09
69 0.09
70 0.09
71 0.1
72 0.1
73 0.11
74 0.11
75 0.2
76 0.26
77 0.35
78 0.43
79 0.51
80 0.57
81 0.63
82 0.73
83 0.74
84 0.78
85 0.8
86 0.82
87 0.81
88 0.81
89 0.8
90 0.76
91 0.68
92 0.63
93 0.55
94 0.46
95 0.4
96 0.33
97 0.27
98 0.21
99 0.2
100 0.15
101 0.17
102 0.2
103 0.18
104 0.19
105 0.24
106 0.26
107 0.33
108 0.36
109 0.36
110 0.37
111 0.38
112 0.35
113 0.32
114 0.32
115 0.24
116 0.22
117 0.19
118 0.18
119 0.17
120 0.23
121 0.23
122 0.24
123 0.32
124 0.39
125 0.47