Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V2JYF3

Protein Details
Accession A0A4V2JYF3   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-33LNNDNFKEERKRKIKKEELKVEIKEBasic
119-142INRFLPSKTRKQIKNKFLNEEKKNHydrophilic
NLS Segment(s)
PositionSequence
18-24RKRKIKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
IPR039467  TFIIIB_B''_Myb  
Pfam View protein in Pfam  
PF15963  Myb_DNA-bind_7  
CDD cd00167  SANT  
Amino Acid Sequences MDPKLSHFLNNDNFKEERKRKIKKEELKVEIKEMSVSLPDKEQESPDILTIRENKIVIDHSATFTVKENTENFQVTNDTDKIITSLTYSKRVPAGRWPKNESDTFFDALSICGTDFTMINRFLPSKTRKQIKNKFLNEEKKNPHKIAAALNKHSTLNPNDFKRLSKFNIEDKENS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.54
3 0.52
4 0.54
5 0.56
6 0.64
7 0.69
8 0.79
9 0.86
10 0.85
11 0.89
12 0.89
13 0.86
14 0.85
15 0.78
16 0.71
17 0.61
18 0.51
19 0.41
20 0.3
21 0.23
22 0.18
23 0.17
24 0.14
25 0.14
26 0.15
27 0.16
28 0.17
29 0.17
30 0.15
31 0.17
32 0.17
33 0.17
34 0.17
35 0.15
36 0.18
37 0.2
38 0.21
39 0.21
40 0.2
41 0.18
42 0.19
43 0.2
44 0.17
45 0.17
46 0.15
47 0.14
48 0.16
49 0.16
50 0.15
51 0.15
52 0.16
53 0.13
54 0.15
55 0.15
56 0.16
57 0.18
58 0.18
59 0.16
60 0.15
61 0.15
62 0.14
63 0.16
64 0.14
65 0.12
66 0.11
67 0.11
68 0.1
69 0.09
70 0.09
71 0.06
72 0.11
73 0.12
74 0.16
75 0.16
76 0.17
77 0.21
78 0.22
79 0.22
80 0.27
81 0.36
82 0.4
83 0.46
84 0.49
85 0.49
86 0.52
87 0.53
88 0.45
89 0.4
90 0.36
91 0.31
92 0.26
93 0.23
94 0.19
95 0.17
96 0.15
97 0.09
98 0.06
99 0.05
100 0.05
101 0.05
102 0.05
103 0.07
104 0.1
105 0.11
106 0.11
107 0.13
108 0.14
109 0.14
110 0.22
111 0.26
112 0.32
113 0.41
114 0.49
115 0.56
116 0.66
117 0.76
118 0.79
119 0.83
120 0.8
121 0.81
122 0.81
123 0.83
124 0.79
125 0.79
126 0.78
127 0.77
128 0.78
129 0.7
130 0.64
131 0.57
132 0.53
133 0.53
134 0.54
135 0.52
136 0.5
137 0.52
138 0.5
139 0.47
140 0.45
141 0.41
142 0.36
143 0.38
144 0.41
145 0.42
146 0.47
147 0.48
148 0.51
149 0.51
150 0.53
151 0.49
152 0.5
153 0.51
154 0.53
155 0.6