Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LWH7

Protein Details
Accession A0A4Q9LWH7    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
148-169ETMARKRKKMLMDKKRERLDKSBasic
NLS Segment(s)
PositionSequence
152-163RKRKKMLMDKKR
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003196  TFIIF_beta  
IPR040450  TFIIF_beta_HTH  
IPR040504  TFIIF_beta_N  
IPR011039  TFIIF_interaction  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005674  C:transcription factor TFIIF complex  
GO:0003677  F:DNA binding  
GO:0003743  F:translation initiation factor activity  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF02270  TFIIF_beta  
PF17683  TFIIF_beta_N  
Amino Acid Sequences MRLETKNSEITVWLVKVPNFLAERLHELEGDIDIGELEITSATENEPASVNIKFSEKVCGSGFPTSFHLDRSEVDKQMYMLKSEKDTSGIEGKVTTECFVRPVINEEYILYRKPRNEITSGPKRMTQVIDFNKDGRIGERIGSISELETMARKRKKMLMDKKRERLDKSHVMDMLFNAFEKHKFWTVKDLADFTGQPVAYIQELISEIGMLNKKDHKNTYELKPEYSYGRDESQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.24
4 0.24
5 0.27
6 0.24
7 0.23
8 0.23
9 0.22
10 0.27
11 0.28
12 0.28
13 0.22
14 0.21
15 0.21
16 0.18
17 0.16
18 0.1
19 0.07
20 0.06
21 0.06
22 0.05
23 0.04
24 0.04
25 0.03
26 0.03
27 0.04
28 0.04
29 0.05
30 0.07
31 0.07
32 0.08
33 0.09
34 0.1
35 0.11
36 0.12
37 0.12
38 0.11
39 0.14
40 0.14
41 0.14
42 0.21
43 0.19
44 0.22
45 0.22
46 0.23
47 0.24
48 0.28
49 0.27
50 0.22
51 0.24
52 0.24
53 0.24
54 0.22
55 0.22
56 0.18
57 0.18
58 0.23
59 0.24
60 0.22
61 0.22
62 0.21
63 0.2
64 0.25
65 0.25
66 0.21
67 0.19
68 0.19
69 0.21
70 0.22
71 0.21
72 0.17
73 0.17
74 0.18
75 0.2
76 0.18
77 0.16
78 0.15
79 0.15
80 0.14
81 0.14
82 0.12
83 0.08
84 0.08
85 0.09
86 0.1
87 0.1
88 0.09
89 0.13
90 0.15
91 0.15
92 0.15
93 0.14
94 0.17
95 0.17
96 0.18
97 0.15
98 0.15
99 0.16
100 0.19
101 0.22
102 0.21
103 0.23
104 0.26
105 0.33
106 0.41
107 0.43
108 0.41
109 0.39
110 0.38
111 0.37
112 0.34
113 0.27
114 0.26
115 0.28
116 0.31
117 0.3
118 0.3
119 0.29
120 0.27
121 0.25
122 0.18
123 0.15
124 0.11
125 0.11
126 0.12
127 0.11
128 0.11
129 0.11
130 0.1
131 0.08
132 0.08
133 0.07
134 0.06
135 0.08
136 0.1
137 0.18
138 0.22
139 0.22
140 0.25
141 0.31
142 0.39
143 0.48
144 0.57
145 0.59
146 0.67
147 0.77
148 0.83
149 0.85
150 0.82
151 0.76
152 0.71
153 0.69
154 0.67
155 0.61
156 0.57
157 0.51
158 0.45
159 0.42
160 0.36
161 0.3
162 0.21
163 0.16
164 0.12
165 0.12
166 0.12
167 0.13
168 0.16
169 0.21
170 0.22
171 0.24
172 0.32
173 0.34
174 0.38
175 0.39
176 0.37
177 0.31
178 0.32
179 0.31
180 0.22
181 0.25
182 0.2
183 0.17
184 0.16
185 0.16
186 0.13
187 0.13
188 0.12
189 0.08
190 0.09
191 0.1
192 0.09
193 0.08
194 0.07
195 0.12
196 0.16
197 0.15
198 0.18
199 0.26
200 0.3
201 0.37
202 0.43
203 0.41
204 0.46
205 0.52
206 0.58
207 0.6
208 0.58
209 0.55
210 0.53
211 0.52
212 0.48
213 0.44
214 0.39