Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9LZT9

Protein Details
Accession A0A4Q9LZT9    Localization Confidence High Confidence Score 20.1
NoLS Segment(s)
PositionSequenceProtein Nature
204-235WNIYFPQIKAKKQKNRKSKIDKREKNDKMPLPHydrophilic
248-274GEYFLDDKKDSKKRKNKKNEKYILPEEBasic
NLS Segment(s)
PositionSequence
212-233KAKKQKNRKSKIDKREKNDKMP
256-266KDSKKRKNKKN
Subcellular Location(s) nucl 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041174  KH_8  
IPR036612  KH_dom_type_1_sf  
IPR024166  rRNA_assembly_KRR1  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF17903  KH_8  
Amino Acid Sequences MALKENIEVEFNEKDFKHNFLEQSEFTVMWPRYREEYLKTNEKLLQEKLQEIKLSLDINYSERYFTVSTTNKTRDPYIIIKGRDMLKLIARGMNLNEASLILKDGFTSEIIVPKELKKEVFLKRKARLVGPNDVTLKALRMLTDCHIVLQTDTISIVGPFKGVTQVVSVVDSCFYENIHPVYLIKKLITFKELQNDKSKKDLDWNIYFPQIKAKKQKNRKSKIDKREKNDKMPLPPPKSNLDKLIETGEYFLDDKKDSKKRKNKKNEKYILPEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.29
4 0.3
5 0.32
6 0.34
7 0.32
8 0.38
9 0.33
10 0.37
11 0.36
12 0.3
13 0.25
14 0.31
15 0.28
16 0.27
17 0.29
18 0.26
19 0.29
20 0.33
21 0.35
22 0.32
23 0.4
24 0.44
25 0.51
26 0.49
27 0.49
28 0.49
29 0.5
30 0.49
31 0.44
32 0.43
33 0.36
34 0.4
35 0.4
36 0.39
37 0.36
38 0.32
39 0.3
40 0.26
41 0.25
42 0.19
43 0.18
44 0.16
45 0.17
46 0.19
47 0.17
48 0.15
49 0.14
50 0.17
51 0.15
52 0.14
53 0.2
54 0.22
55 0.26
56 0.33
57 0.37
58 0.37
59 0.38
60 0.39
61 0.33
62 0.34
63 0.35
64 0.35
65 0.38
66 0.36
67 0.35
68 0.38
69 0.38
70 0.34
71 0.31
72 0.24
73 0.2
74 0.22
75 0.22
76 0.2
77 0.18
78 0.18
79 0.17
80 0.2
81 0.17
82 0.14
83 0.13
84 0.11
85 0.11
86 0.1
87 0.1
88 0.05
89 0.05
90 0.05
91 0.06
92 0.06
93 0.06
94 0.08
95 0.07
96 0.12
97 0.12
98 0.13
99 0.14
100 0.15
101 0.18
102 0.17
103 0.17
104 0.16
105 0.23
106 0.31
107 0.4
108 0.46
109 0.5
110 0.53
111 0.57
112 0.56
113 0.53
114 0.51
115 0.46
116 0.46
117 0.41
118 0.41
119 0.37
120 0.35
121 0.32
122 0.25
123 0.21
124 0.14
125 0.12
126 0.08
127 0.08
128 0.09
129 0.1
130 0.13
131 0.12
132 0.11
133 0.11
134 0.1
135 0.1
136 0.09
137 0.08
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.04
145 0.04
146 0.04
147 0.05
148 0.06
149 0.06
150 0.06
151 0.06
152 0.08
153 0.08
154 0.08
155 0.08
156 0.07
157 0.08
158 0.07
159 0.07
160 0.06
161 0.06
162 0.06
163 0.08
164 0.09
165 0.09
166 0.09
167 0.1
168 0.11
169 0.13
170 0.14
171 0.12
172 0.15
173 0.17
174 0.18
175 0.2
176 0.21
177 0.21
178 0.3
179 0.33
180 0.33
181 0.41
182 0.43
183 0.42
184 0.47
185 0.46
186 0.37
187 0.42
188 0.46
189 0.43
190 0.45
191 0.47
192 0.42
193 0.46
194 0.46
195 0.37
196 0.41
197 0.39
198 0.4
199 0.46
200 0.55
201 0.6
202 0.7
203 0.8
204 0.81
205 0.85
206 0.89
207 0.9
208 0.91
209 0.92
210 0.92
211 0.91
212 0.89
213 0.9
214 0.87
215 0.85
216 0.84
217 0.79
218 0.76
219 0.76
220 0.78
221 0.75
222 0.72
223 0.66
224 0.64
225 0.64
226 0.6
227 0.58
228 0.52
229 0.46
230 0.43
231 0.43
232 0.36
233 0.3
234 0.27
235 0.2
236 0.17
237 0.16
238 0.16
239 0.15
240 0.15
241 0.19
242 0.27
243 0.37
244 0.45
245 0.55
246 0.65
247 0.73
248 0.82
249 0.9
250 0.92
251 0.93
252 0.95
253 0.94
254 0.93