Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LYQ9

Protein Details
Accession A0A4Q9LYQ9    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
193-213IDYIWHKKQKNDKNYNYNGKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 8, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008922  Di-copper_centre_dom_sf  
IPR002227  Tyrosinase_Cu-bd  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF00264  Tyrosinase  
PROSITE View protein in PROSITE  
PS00497  TYROSINASE_1  
PS00498  TYROSINASE_2  
Amino Acid Sequences MYDLCKKYVIRKEIRDMTEKEWMKYKDALLKVYKEGLIEEITKIHVFVDDYAHNNDRFLPWHRMFLLYFESILQFISNDDSLCVPYWDWTLDAENPSDSIIFSEKYLGFNECLKLYFPSEHCLKRKEGIINPFYNKSKINKLLKIKKDYKEFREALEIVPHALVHAFVGGEDGDMSMMYSTNDPIFWHHHSFIDYIWHKKQKNDKNYNYNGKDNKGNKVSKEDILFPFNKKVKDILKLEDCCVKYKEYNHVKIQTYDDLNIYRLPESYIKRHKYSLNKVRKIENSLQEIKRQSRLKKIFIFLKKLFID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.74
3 0.68
4 0.63
5 0.64
6 0.59
7 0.51
8 0.5
9 0.47
10 0.44
11 0.44
12 0.43
13 0.42
14 0.43
15 0.47
16 0.44
17 0.46
18 0.44
19 0.44
20 0.4
21 0.32
22 0.29
23 0.25
24 0.22
25 0.19
26 0.17
27 0.15
28 0.16
29 0.15
30 0.15
31 0.12
32 0.11
33 0.11
34 0.11
35 0.15
36 0.16
37 0.19
38 0.23
39 0.27
40 0.25
41 0.25
42 0.25
43 0.22
44 0.23
45 0.25
46 0.3
47 0.28
48 0.33
49 0.34
50 0.35
51 0.33
52 0.32
53 0.31
54 0.22
55 0.21
56 0.16
57 0.16
58 0.13
59 0.13
60 0.11
61 0.06
62 0.06
63 0.08
64 0.08
65 0.08
66 0.08
67 0.09
68 0.1
69 0.1
70 0.11
71 0.08
72 0.09
73 0.1
74 0.1
75 0.1
76 0.1
77 0.12
78 0.13
79 0.14
80 0.14
81 0.13
82 0.13
83 0.12
84 0.12
85 0.09
86 0.08
87 0.08
88 0.08
89 0.08
90 0.11
91 0.12
92 0.13
93 0.14
94 0.15
95 0.14
96 0.16
97 0.17
98 0.14
99 0.14
100 0.14
101 0.14
102 0.14
103 0.17
104 0.16
105 0.19
106 0.23
107 0.29
108 0.31
109 0.33
110 0.33
111 0.32
112 0.37
113 0.39
114 0.39
115 0.41
116 0.43
117 0.44
118 0.45
119 0.46
120 0.42
121 0.38
122 0.35
123 0.3
124 0.32
125 0.37
126 0.41
127 0.43
128 0.51
129 0.59
130 0.64
131 0.69
132 0.7
133 0.67
134 0.7
135 0.7
136 0.65
137 0.65
138 0.58
139 0.5
140 0.47
141 0.42
142 0.33
143 0.29
144 0.24
145 0.15
146 0.14
147 0.13
148 0.08
149 0.07
150 0.06
151 0.03
152 0.04
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.04
166 0.04
167 0.05
168 0.05
169 0.05
170 0.06
171 0.08
172 0.12
173 0.16
174 0.19
175 0.19
176 0.2
177 0.21
178 0.22
179 0.2
180 0.24
181 0.23
182 0.24
183 0.3
184 0.37
185 0.37
186 0.43
187 0.52
188 0.53
189 0.62
190 0.68
191 0.7
192 0.73
193 0.81
194 0.85
195 0.79
196 0.78
197 0.7
198 0.63
199 0.63
200 0.56
201 0.55
202 0.53
203 0.52
204 0.46
205 0.49
206 0.49
207 0.44
208 0.43
209 0.41
210 0.36
211 0.37
212 0.38
213 0.33
214 0.38
215 0.39
216 0.38
217 0.33
218 0.36
219 0.36
220 0.42
221 0.42
222 0.41
223 0.46
224 0.47
225 0.48
226 0.49
227 0.46
228 0.41
229 0.39
230 0.35
231 0.31
232 0.33
233 0.42
234 0.44
235 0.51
236 0.55
237 0.6
238 0.6
239 0.59
240 0.59
241 0.54
242 0.47
243 0.41
244 0.36
245 0.3
246 0.28
247 0.27
248 0.24
249 0.18
250 0.16
251 0.17
252 0.21
253 0.25
254 0.34
255 0.42
256 0.47
257 0.5
258 0.55
259 0.59
260 0.63
261 0.7
262 0.7
263 0.71
264 0.74
265 0.74
266 0.78
267 0.77
268 0.74
269 0.72
270 0.7
271 0.67
272 0.68
273 0.66
274 0.64
275 0.66
276 0.62
277 0.62
278 0.62
279 0.6
280 0.61
281 0.66
282 0.69
283 0.69
284 0.73
285 0.74
286 0.74
287 0.77
288 0.68