A0A4Q9M4Q5

UniProt ID: A0A4Q9M4Q5   Organism: Hamiltosporidium tvaerminnensis
Gene: CWI38_0005p0140   Protein: Uncharacterized protein
Length: 102 AA

Protein Details

• Accession: A0A4Q9M4Q5
• Localization Confidence: Medium
• Confidence Score: 11.6
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  2-27	EKQEEENSRNKKNKNKNKKVTFLEEN	Hydrophilic

• NLS Segment(s):

  Position	Sequence
  13-15	KNK

• Subcellular Location(s): nucl 13.5, cyto_nucl 11, mito 8, cyto 5.5
• Family & Domain DBs:
  • InterPro:
    • IPR007062 PPI-2
  • Gene Ontology:
    • GO:0004864 F:protein phosphatase inhibitor activity
    • GO:0043666 P:regulation of phosphoprotein phosphatase activity
    • GO:0009966 P:regulation of signal transduction
  • Pfam:
    • PF04979 IPP-2
• Amino Acid Sequences: MEKQEEENSRNKKNKNKNKKVTFLEENLEANEKYFNECSFKEIEEPKTPYNREEETDFDSFSTTESTDEDSGYVSNH

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.79
2, 0.82
3, 0.86
4, 0.87
5, 0.89
6, 0.91
7, 0.87
8, 0.84
9, 0.79
10, 0.7
11, 0.62
12, 0.53
13, 0.45
14, 0.36
15, 0.32
16, 0.23
17, 0.17
18, 0.15
19, 0.12
20, 0.12
21, 0.12
22, 0.12
23, 0.13
24, 0.13
25, 0.15
26, 0.14
27, 0.15
28, 0.16
29, 0.19
30, 0.23
31, 0.26
32, 0.3
33, 0.31
34, 0.36
35, 0.37
36, 0.34
37, 0.36
38, 0.33
39, 0.3
40, 0.28
41, 0.28
42, 0.27
43, 0.28
44, 0.27
45, 0.21
46, 0.2
47, 0.18
48, 0.16
49, 0.14
50, 0.09
51, 0.09
52, 0.1
53, 0.13
54, 0.13
55, 0.13
56, 0.13
57, 0.12