Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LY67

Protein Details
Accession A0A4Q9LY67   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
41-67EENPNPNKIAQKKRRGRKFKLFDNLPVHydrophilic
NLS Segment(s)
PositionSequence
50-59AQKKRRGRKF
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
Amino Acid Sequences MFLISVTKVNCLNYPTRNQNNIAAMFIIEENPDKRVSSLIEENPNPNKIAQKKRRGRKFKLFDNLPVMKIQIIATNFNKPKVFREESTKDESKENNNQIEEKDNVQDESREEENDENKYDGECNIENSDEKDRVKDSDTDNKIERDKENNVEKNDEKESLQDKILVEENEDNENSSETKSGDCDENEEDTSEKTSEEAENNVEQDEEEDTYINEDNQKDLTKEEASDLYEKTDKVQDLAMEENSNEDTNSKNQKELLEMTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.47
3 0.54
4 0.57
5 0.57
6 0.59
7 0.59
8 0.54
9 0.46
10 0.36
11 0.27
12 0.24
13 0.21
14 0.16
15 0.1
16 0.12
17 0.12
18 0.14
19 0.15
20 0.14
21 0.14
22 0.16
23 0.17
24 0.19
25 0.26
26 0.3
27 0.37
28 0.38
29 0.44
30 0.46
31 0.46
32 0.41
33 0.35
34 0.37
35 0.38
36 0.48
37 0.52
38 0.58
39 0.67
40 0.76
41 0.86
42 0.88
43 0.89
44 0.89
45 0.88
46 0.86
47 0.87
48 0.81
49 0.76
50 0.74
51 0.67
52 0.57
53 0.48
54 0.39
55 0.28
56 0.25
57 0.2
58 0.15
59 0.13
60 0.17
61 0.18
62 0.27
63 0.28
64 0.31
65 0.33
66 0.3
67 0.33
68 0.37
69 0.4
70 0.33
71 0.41
72 0.43
73 0.45
74 0.52
75 0.5
76 0.43
77 0.42
78 0.43
79 0.4
80 0.44
81 0.45
82 0.41
83 0.39
84 0.39
85 0.36
86 0.37
87 0.32
88 0.24
89 0.21
90 0.17
91 0.17
92 0.16
93 0.16
94 0.13
95 0.16
96 0.15
97 0.13
98 0.14
99 0.15
100 0.17
101 0.18
102 0.18
103 0.14
104 0.13
105 0.13
106 0.13
107 0.11
108 0.12
109 0.1
110 0.11
111 0.11
112 0.11
113 0.11
114 0.13
115 0.16
116 0.15
117 0.15
118 0.15
119 0.15
120 0.15
121 0.17
122 0.19
123 0.2
124 0.27
125 0.3
126 0.32
127 0.33
128 0.34
129 0.34
130 0.32
131 0.3
132 0.26
133 0.27
134 0.3
135 0.37
136 0.41
137 0.4
138 0.43
139 0.42
140 0.4
141 0.39
142 0.34
143 0.25
144 0.24
145 0.24
146 0.21
147 0.21
148 0.2
149 0.17
150 0.18
151 0.22
152 0.17
153 0.17
154 0.17
155 0.18
156 0.17
157 0.17
158 0.16
159 0.13
160 0.14
161 0.12
162 0.11
163 0.1
164 0.09
165 0.09
166 0.09
167 0.11
168 0.13
169 0.12
170 0.15
171 0.16
172 0.18
173 0.18
174 0.18
175 0.17
176 0.15
177 0.17
178 0.14
179 0.12
180 0.09
181 0.11
182 0.12
183 0.13
184 0.14
185 0.15
186 0.16
187 0.16
188 0.16
189 0.14
190 0.12
191 0.12
192 0.12
193 0.1
194 0.08
195 0.08
196 0.08
197 0.1
198 0.11
199 0.11
200 0.13
201 0.12
202 0.14
203 0.16
204 0.18
205 0.17
206 0.17
207 0.21
208 0.18
209 0.19
210 0.2
211 0.2
212 0.2
213 0.22
214 0.22
215 0.22
216 0.24
217 0.23
218 0.23
219 0.27
220 0.24
221 0.23
222 0.25
223 0.21
224 0.22
225 0.25
226 0.24
227 0.2
228 0.19
229 0.2
230 0.19
231 0.18
232 0.16
233 0.13
234 0.14
235 0.21
236 0.31
237 0.31
238 0.32
239 0.34
240 0.36
241 0.4