Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LHA7

Protein Details
Accession A0A4Q9LHA7   
Localization Confidence High
Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MNSTKFKPTKRGAEIKNKPDEKHydrophilic
67-92KPKEKYSDLKYKGKKFYKKIPKIASIHydrophilic
NLS Segment(s)
PositionSequence
7-39KPTKRGAEIKNKPDEKSKQKKSVSHLKDQNRKI
63-88KIANKPKEKYSDLKYKGKKFYKKIPK
Subcellular Location(s) nucl 15, cyto 7, mito 5
Family & Domain DBs
Amino Acid Sequences MNSTKFKPTKRGAEIKNKPDEKSKQKKSVSHLKDQNRKINKFKDKLEDKIDFYNDKLKYFTKKIANKPKEKYSDLKYKGKKFYKKIPKIASI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.83
4 0.76
5 0.69
6 0.68
7 0.69
8 0.69
9 0.7
10 0.71
11 0.71
12 0.74
13 0.77
14 0.75
15 0.77
16 0.72
17 0.71
18 0.7
19 0.69
20 0.72
21 0.73
22 0.75
23 0.73
24 0.73
25 0.7
26 0.71
27 0.71
28 0.67
29 0.64
30 0.64
31 0.6
32 0.6
33 0.58
34 0.51
35 0.44
36 0.42
37 0.4
38 0.31
39 0.28
40 0.3
41 0.25
42 0.23
43 0.23
44 0.22
45 0.26
46 0.28
47 0.35
48 0.37
49 0.44
50 0.53
51 0.63
52 0.7
53 0.73
54 0.76
55 0.79
56 0.76
57 0.72
58 0.69
59 0.65
60 0.67
61 0.65
62 0.68
63 0.68
64 0.7
65 0.76
66 0.79
67 0.81
68 0.77
69 0.82
70 0.83
71 0.84
72 0.86