Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9M3N1

Protein Details
Accession A0A4Q9M3N1   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-58STTYKIPKYLKRVKNNIVLVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, cyto 8.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016193  Cytidine_deaminase-like  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006139  P:nucleobase-containing compound metabolic process  
Amino Acid Sequences MSVVKRLVTVEEEKQIETIKAIACEVNKEELSTFLQKISTTYKIPKYLKRVKNNIVLVSLETTLNISFLPNTLVVDVPSTQPITREQYDQCKKIWPCNFYPKKIEKLELPNTLILSVFQNIYEINNSKGINEINYSKDLNNILDLTDYKNISFIKNNLQIDNNISEKQFFYQFFYQFFTNVNKKKENILFCCGTACIIDTSNKKVIEISKDTSHILEHAIFKCIEKVSKNKETYLCTGYDAFCVFEPCISCGMALVHARIQRLFSIFPNKHSGIFSVHRLNQNPNINHRFEVYFLKEKYKKNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.27
4 0.23
5 0.22
6 0.17
7 0.16
8 0.17
9 0.18
10 0.17
11 0.21
12 0.23
13 0.25
14 0.23
15 0.23
16 0.22
17 0.22
18 0.26
19 0.26
20 0.24
21 0.2
22 0.21
23 0.2
24 0.23
25 0.26
26 0.25
27 0.25
28 0.32
29 0.37
30 0.45
31 0.51
32 0.56
33 0.61
34 0.67
35 0.73
36 0.75
37 0.78
38 0.77
39 0.8
40 0.78
41 0.7
42 0.61
43 0.52
44 0.43
45 0.35
46 0.29
47 0.19
48 0.14
49 0.12
50 0.1
51 0.1
52 0.08
53 0.06
54 0.06
55 0.06
56 0.08
57 0.07
58 0.08
59 0.08
60 0.09
61 0.08
62 0.1
63 0.1
64 0.09
65 0.11
66 0.12
67 0.11
68 0.12
69 0.16
70 0.2
71 0.21
72 0.24
73 0.26
74 0.36
75 0.43
76 0.44
77 0.41
78 0.44
79 0.44
80 0.49
81 0.52
82 0.46
83 0.45
84 0.55
85 0.61
86 0.56
87 0.64
88 0.6
89 0.62
90 0.6
91 0.55
92 0.5
93 0.52
94 0.54
95 0.5
96 0.46
97 0.39
98 0.36
99 0.34
100 0.28
101 0.19
102 0.13
103 0.1
104 0.08
105 0.07
106 0.07
107 0.07
108 0.08
109 0.1
110 0.09
111 0.1
112 0.13
113 0.13
114 0.13
115 0.15
116 0.15
117 0.13
118 0.14
119 0.15
120 0.13
121 0.15
122 0.16
123 0.14
124 0.16
125 0.16
126 0.14
127 0.13
128 0.11
129 0.09
130 0.09
131 0.09
132 0.09
133 0.11
134 0.11
135 0.1
136 0.12
137 0.13
138 0.13
139 0.14
140 0.14
141 0.19
142 0.25
143 0.26
144 0.25
145 0.25
146 0.25
147 0.25
148 0.27
149 0.21
150 0.15
151 0.14
152 0.14
153 0.13
154 0.14
155 0.15
156 0.13
157 0.16
158 0.2
159 0.21
160 0.21
161 0.24
162 0.22
163 0.19
164 0.21
165 0.22
166 0.25
167 0.3
168 0.33
169 0.34
170 0.35
171 0.41
172 0.45
173 0.46
174 0.43
175 0.42
176 0.39
177 0.36
178 0.36
179 0.29
180 0.23
181 0.16
182 0.13
183 0.08
184 0.08
185 0.13
186 0.14
187 0.19
188 0.24
189 0.24
190 0.23
191 0.24
192 0.26
193 0.28
194 0.31
195 0.31
196 0.28
197 0.3
198 0.31
199 0.29
200 0.26
201 0.19
202 0.16
203 0.15
204 0.18
205 0.17
206 0.19
207 0.19
208 0.19
209 0.21
210 0.21
211 0.21
212 0.2
213 0.28
214 0.34
215 0.43
216 0.45
217 0.48
218 0.51
219 0.52
220 0.53
221 0.47
222 0.39
223 0.32
224 0.32
225 0.27
226 0.24
227 0.2
228 0.16
229 0.14
230 0.15
231 0.13
232 0.13
233 0.14
234 0.13
235 0.14
236 0.14
237 0.13
238 0.12
239 0.12
240 0.14
241 0.14
242 0.14
243 0.17
244 0.19
245 0.21
246 0.2
247 0.21
248 0.19
249 0.21
250 0.21
251 0.22
252 0.31
253 0.31
254 0.35
255 0.41
256 0.4
257 0.39
258 0.39
259 0.36
260 0.31
261 0.34
262 0.36
263 0.37
264 0.41
265 0.45
266 0.47
267 0.52
268 0.54
269 0.6
270 0.58
271 0.6
272 0.6
273 0.57
274 0.55
275 0.52
276 0.45
277 0.37
278 0.4
279 0.38
280 0.4
281 0.39
282 0.49
283 0.53