Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9LTJ6

Protein Details
Accession A0A4Q9LTJ6    Localization Confidence High Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MSKPNKTTSEQKKRKQKKEKTNHKVTPLTLHydrophilic
70-94LEYLRKDKDRRCKKFLKSRLGTLRTHydrophilic
NLS Segment(s)
PositionSequence
12-24KKRKQKKEKTNHK
77-98KDRRCKKFLKSRLGTLRTAKKK
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
Amino Acid Sequences MSKPNKTTSEQKKRKQKKEKTNHKVTPLTLERLPRPGKKTMLSTKNEKVLFARSIVTEICGLSPYEKKALEYLRKDKDRRCKKFLKSRLGTLRTAKKKLEALSSRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.93
3 0.92
4 0.92
5 0.93
6 0.95
7 0.94
8 0.94
9 0.9
10 0.87
11 0.81
12 0.71
13 0.69
14 0.62
15 0.55
16 0.47
17 0.44
18 0.38
19 0.4
20 0.45
21 0.4
22 0.4
23 0.41
24 0.42
25 0.41
26 0.47
27 0.49
28 0.52
29 0.51
30 0.53
31 0.52
32 0.55
33 0.52
34 0.44
35 0.36
36 0.32
37 0.28
38 0.22
39 0.19
40 0.12
41 0.13
42 0.13
43 0.12
44 0.09
45 0.08
46 0.07
47 0.07
48 0.07
49 0.08
50 0.1
51 0.11
52 0.14
53 0.14
54 0.15
55 0.18
56 0.25
57 0.31
58 0.37
59 0.44
60 0.5
61 0.58
62 0.62
63 0.65
64 0.69
65 0.72
66 0.73
67 0.73
68 0.74
69 0.76
70 0.83
71 0.85
72 0.85
73 0.8
74 0.81
75 0.83
76 0.78
77 0.73
78 0.71
79 0.72
80 0.69
81 0.69
82 0.61
83 0.56
84 0.58
85 0.57
86 0.58