Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9M594

Protein Details
Accession A0A4Q9M594    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
18-47IFKNWFDKNANKERRRERRIKKAKMIYPMPHydrophilic
NLS Segment(s)
PositionSequence
28-41NKERRRERRIKKAK
Subcellular Location(s) mito 14, nucl 12.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001380  Ribosomal_L13e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01294  Ribosomal_L13e  
Amino Acid Sequences MRRNNALVSNHFKKSSLIFKNWFDKNANKERRRERRIKKAKMIYPMPLNKLKPVVRCRSARYNWKERYGKGFTFEECKSAGLDYRYARTIGISVDSRRRNTSKEAFDQNVLRIKEYLSKIVIYKDRKEAVKSKVEQYKGVLLPIRNEPKKIESISVEEILNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.42
4 0.43
5 0.45
6 0.5
7 0.58
8 0.59
9 0.57
10 0.51
11 0.51
12 0.53
13 0.58
14 0.62
15 0.6
16 0.66
17 0.74
18 0.8
19 0.83
20 0.85
21 0.84
22 0.85
23 0.89
24 0.9
25 0.9
26 0.88
27 0.84
28 0.83
29 0.76
30 0.7
31 0.69
32 0.64
33 0.58
34 0.55
35 0.5
36 0.43
37 0.46
38 0.44
39 0.43
40 0.46
41 0.48
42 0.49
43 0.52
44 0.55
45 0.58
46 0.61
47 0.63
48 0.63
49 0.66
50 0.64
51 0.7
52 0.68
53 0.6
54 0.61
55 0.57
56 0.49
57 0.43
58 0.4
59 0.31
60 0.32
61 0.3
62 0.24
63 0.18
64 0.18
65 0.14
66 0.13
67 0.14
68 0.1
69 0.13
70 0.12
71 0.14
72 0.14
73 0.14
74 0.14
75 0.12
76 0.11
77 0.08
78 0.1
79 0.11
80 0.12
81 0.2
82 0.23
83 0.25
84 0.29
85 0.31
86 0.3
87 0.36
88 0.41
89 0.4
90 0.43
91 0.47
92 0.45
93 0.46
94 0.45
95 0.41
96 0.4
97 0.34
98 0.29
99 0.23
100 0.22
101 0.26
102 0.26
103 0.26
104 0.2
105 0.21
106 0.22
107 0.27
108 0.33
109 0.31
110 0.33
111 0.37
112 0.41
113 0.42
114 0.47
115 0.48
116 0.48
117 0.53
118 0.52
119 0.54
120 0.56
121 0.55
122 0.52
123 0.48
124 0.5
125 0.41
126 0.41
127 0.38
128 0.31
129 0.33
130 0.4
131 0.48
132 0.42
133 0.43
134 0.43
135 0.43
136 0.48
137 0.47
138 0.42
139 0.35
140 0.39
141 0.42
142 0.4