Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V2JXA7

Protein Details
Accession A0A4V2JXA7    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
80-99DKGYRCRRDGCRRRKSVRGEBasic
190-216AKNAIKKEAEERKKRSKTQREEFFAKYHydrophilic
NLS Segment(s)
PositionSequence
194-206IKKEAEERKKRSK
Subcellular Location(s) nucl 19.5, mito_nucl 12, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
IPR018282  Ribosomal_S6e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
PROSITE View protein in PROSITE  
PS00578  RIBOSOMAL_S6E  
Amino Acid Sequences MKLNIAYPTNGTQKLISVERKVEQRLYDQKIGNTFEGSILGPEYNGYVFEITGGDDRQGFPMRRGVPSSARVRLLLKKGDKGYRCRRDGCRRRKSVRGEIVSSEISVLSVIIVQKGDTEIAGVTDRVESCSHLPKRASKLRERFEIPEGADIKKFLVESITKAAKESGQEKVKIPRIRITGEWTQEKEDAKNAIKKEAEERKKRSKTQREEFFAKYPELQQVKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.34
4 0.32
5 0.35
6 0.39
7 0.44
8 0.45
9 0.44
10 0.4
11 0.43
12 0.48
13 0.51
14 0.54
15 0.51
16 0.5
17 0.52
18 0.53
19 0.45
20 0.37
21 0.3
22 0.23
23 0.21
24 0.18
25 0.13
26 0.1
27 0.09
28 0.08
29 0.08
30 0.08
31 0.07
32 0.07
33 0.07
34 0.06
35 0.06
36 0.07
37 0.07
38 0.07
39 0.09
40 0.08
41 0.08
42 0.09
43 0.1
44 0.13
45 0.18
46 0.18
47 0.18
48 0.25
49 0.27
50 0.28
51 0.3
52 0.3
53 0.29
54 0.36
55 0.4
56 0.36
57 0.35
58 0.34
59 0.35
60 0.37
61 0.37
62 0.38
63 0.35
64 0.37
65 0.41
66 0.47
67 0.48
68 0.52
69 0.58
70 0.6
71 0.61
72 0.62
73 0.67
74 0.71
75 0.77
76 0.79
77 0.78
78 0.79
79 0.8
80 0.81
81 0.8
82 0.78
83 0.77
84 0.7
85 0.62
86 0.53
87 0.51
88 0.42
89 0.34
90 0.24
91 0.15
92 0.1
93 0.08
94 0.06
95 0.03
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.05
103 0.05
104 0.04
105 0.04
106 0.03
107 0.04
108 0.05
109 0.05
110 0.05
111 0.06
112 0.06
113 0.07
114 0.08
115 0.08
116 0.1
117 0.2
118 0.21
119 0.24
120 0.26
121 0.3
122 0.39
123 0.45
124 0.49
125 0.49
126 0.57
127 0.58
128 0.62
129 0.6
130 0.55
131 0.51
132 0.49
133 0.4
134 0.37
135 0.33
136 0.28
137 0.25
138 0.22
139 0.19
140 0.16
141 0.15
142 0.09
143 0.11
144 0.1
145 0.12
146 0.19
147 0.22
148 0.2
149 0.21
150 0.22
151 0.2
152 0.23
153 0.23
154 0.25
155 0.27
156 0.3
157 0.32
158 0.4
159 0.47
160 0.48
161 0.48
162 0.46
163 0.45
164 0.46
165 0.45
166 0.44
167 0.42
168 0.44
169 0.47
170 0.42
171 0.41
172 0.41
173 0.41
174 0.36
175 0.33
176 0.33
177 0.33
178 0.37
179 0.35
180 0.39
181 0.38
182 0.39
183 0.45
184 0.49
185 0.54
186 0.58
187 0.65
188 0.69
189 0.77
190 0.85
191 0.86
192 0.86
193 0.87
194 0.88
195 0.9
196 0.87
197 0.84
198 0.8
199 0.75
200 0.68
201 0.6
202 0.52
203 0.44
204 0.45