Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LT12

Protein Details
Accession A0A4Q9LT12    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
68-96DIEEERKWLKKWKKTYKNRKNILTHNIINHydrophilic
NLS Segment(s)
PositionSequence
77-81KKWKK
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
Amino Acid Sequences NAEESWERASMGVIMRAKMHEELKPYLKEEKREEDGAKNFKPKNKAPFIPQGRTTLEEPTNNINKESDIEEERKWLKKWKKTYKNRKNILTHNIINDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.19
4 0.21
5 0.22
6 0.23
7 0.19
8 0.22
9 0.27
10 0.32
11 0.33
12 0.33
13 0.39
14 0.4
15 0.44
16 0.45
17 0.47
18 0.45
19 0.47
20 0.47
21 0.45
22 0.48
23 0.48
24 0.46
25 0.47
26 0.45
27 0.45
28 0.49
29 0.48
30 0.5
31 0.5
32 0.5
33 0.47
34 0.55
35 0.57
36 0.54
37 0.51
38 0.45
39 0.39
40 0.39
41 0.35
42 0.3
43 0.26
44 0.23
45 0.23
46 0.25
47 0.3
48 0.28
49 0.27
50 0.23
51 0.21
52 0.21
53 0.21
54 0.18
55 0.16
56 0.19
57 0.18
58 0.24
59 0.27
60 0.31
61 0.31
62 0.38
63 0.44
64 0.5
65 0.61
66 0.67
67 0.74
68 0.8
69 0.9
70 0.91
71 0.93
72 0.93
73 0.92
74 0.89
75 0.87
76 0.85
77 0.83
78 0.75