Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V2JVJ9

Protein Details
Accession A0A4V2JVJ9    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
95-118KQLSMKVHRVRKTRKLFPKVYFSYHydrophilic
NLS Segment(s)
PositionSequence
82-96PKLTKAKRLALTPKQ
98-108SMKVHRVRKTR
Subcellular Location(s) mito 12, nucl 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
Amino Acid Sequences MKIERDFFKVQSKEDLSKTILDLRSVLLSLRQKKASGNIEPNEMFEARKNLARAIGVLREKELLEEIDKYKDAAKLPKHLMPKLTKAKRLALTPKQLSMKVHRVRKTRKLFPKVYFSYAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.37
4 0.36
5 0.35
6 0.34
7 0.3
8 0.25
9 0.23
10 0.21
11 0.2
12 0.18
13 0.17
14 0.15
15 0.22
16 0.27
17 0.32
18 0.32
19 0.32
20 0.34
21 0.41
22 0.42
23 0.41
24 0.43
25 0.39
26 0.42
27 0.42
28 0.41
29 0.35
30 0.29
31 0.22
32 0.16
33 0.18
34 0.14
35 0.17
36 0.16
37 0.15
38 0.15
39 0.15
40 0.14
41 0.13
42 0.17
43 0.16
44 0.15
45 0.15
46 0.15
47 0.15
48 0.14
49 0.13
50 0.08
51 0.08
52 0.1
53 0.1
54 0.11
55 0.11
56 0.12
57 0.13
58 0.15
59 0.16
60 0.21
61 0.23
62 0.28
63 0.32
64 0.37
65 0.39
66 0.39
67 0.43
68 0.41
69 0.47
70 0.51
71 0.53
72 0.55
73 0.53
74 0.59
75 0.56
76 0.59
77 0.59
78 0.56
79 0.6
80 0.57
81 0.59
82 0.56
83 0.54
84 0.51
85 0.5
86 0.52
87 0.51
88 0.56
89 0.58
90 0.64
91 0.71
92 0.78
93 0.8
94 0.8
95 0.82
96 0.84
97 0.85
98 0.82
99 0.83
100 0.78