Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LNA0

Protein Details
Accession A0A4Q9LNA0    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
39-58VEKERLKHKKNRSTERIQEIBasic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR031547  DUF5089  
Pfam View protein in Pfam  
PF17002  DUF5089  
Amino Acid Sequences KITKDIKREGKLFGFHVPLIGKIKHLFSSDRKIEKEVEVEKERLKHKKNRSTERIQEISSDDEHFNQNSDDEVVKGEGMTNKELYKISNKLKEMNSEAEIQKSELKKQKGDIKKISKVNENSEQIMDRTTEELKKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.34
3 0.35
4 0.29
5 0.27
6 0.28
7 0.25
8 0.23
9 0.22
10 0.24
11 0.24
12 0.25
13 0.27
14 0.27
15 0.37
16 0.42
17 0.46
18 0.45
19 0.45
20 0.45
21 0.43
22 0.43
23 0.38
24 0.37
25 0.35
26 0.36
27 0.36
28 0.39
29 0.43
30 0.45
31 0.49
32 0.5
33 0.57
34 0.65
35 0.72
36 0.77
37 0.79
38 0.79
39 0.8
40 0.79
41 0.71
42 0.62
43 0.53
44 0.44
45 0.38
46 0.3
47 0.24
48 0.16
49 0.14
50 0.15
51 0.14
52 0.13
53 0.11
54 0.1
55 0.08
56 0.08
57 0.07
58 0.06
59 0.07
60 0.06
61 0.06
62 0.06
63 0.07
64 0.08
65 0.1
66 0.11
67 0.12
68 0.12
69 0.13
70 0.14
71 0.14
72 0.17
73 0.22
74 0.27
75 0.33
76 0.34
77 0.38
78 0.4
79 0.43
80 0.41
81 0.39
82 0.34
83 0.32
84 0.32
85 0.28
86 0.27
87 0.23
88 0.25
89 0.23
90 0.29
91 0.32
92 0.35
93 0.36
94 0.42
95 0.51
96 0.55
97 0.63
98 0.65
99 0.66
100 0.71
101 0.75
102 0.74
103 0.73
104 0.69
105 0.67
106 0.66
107 0.61
108 0.55
109 0.51
110 0.47
111 0.38
112 0.35
113 0.28
114 0.2
115 0.19
116 0.21