Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LFK9

Protein Details
Accession A0A4Q9LFK9    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
72-96MEDLKNNKSTTRKNNKRGKKGMQKKHydrophilic
NLS Segment(s)
PositionSequence
82-96TRKNNKRGKKGMQKK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.833, cyto 5, cyto_pero 3.499
Family & Domain DBs
Amino Acid Sequences MNEEKDELLDKMPEKVISYFYETEILKDADELKECNQRLNELESFHIFKEIKNSEVKKKIESQDPALVKAYMEDLKNNKSTTRKNNKRGKKGMQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.22
4 0.21
5 0.25
6 0.23
7 0.22
8 0.26
9 0.23
10 0.23
11 0.23
12 0.21
13 0.15
14 0.15
15 0.16
16 0.13
17 0.14
18 0.15
19 0.15
20 0.22
21 0.22
22 0.25
23 0.24
24 0.23
25 0.24
26 0.27
27 0.26
28 0.19
29 0.21
30 0.19
31 0.2
32 0.18
33 0.2
34 0.15
35 0.14
36 0.2
37 0.2
38 0.2
39 0.25
40 0.29
41 0.32
42 0.4
43 0.42
44 0.37
45 0.44
46 0.46
47 0.47
48 0.48
49 0.45
50 0.45
51 0.45
52 0.43
53 0.38
54 0.33
55 0.25
56 0.22
57 0.2
58 0.15
59 0.15
60 0.18
61 0.2
62 0.25
63 0.29
64 0.29
65 0.31
66 0.36
67 0.44
68 0.51
69 0.58
70 0.65
71 0.71
72 0.81
73 0.87
74 0.9
75 0.91
76 0.91