Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V2JU95

Protein Details
Accession A0A4V2JU95    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MQTNRAPPTRKQKLKACMNCSQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, mito_nucl 14, mito 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029040  RPABC4/Spt4  
IPR009287  Spt4  
IPR022800  Spt4/RpoE2_Znf  
IPR038510  Spt4_sf  
Gene Ontology GO:0000775  C:chromosome, centromeric region  
GO:0005634  C:nucleus  
GO:0003746  F:translation elongation factor activity  
GO:0008270  F:zinc ion binding  
GO:0032786  P:positive regulation of DNA-templated transcription, elongation  
Pfam View protein in Pfam  
PF06093  Spt4  
CDD cd07973  Spt4  
Amino Acid Sequences MQTNRAPPTRKQKLKACMNCSQIKQSNLFRRDGCENCEFLNLKNNHENVIECVSDRYKGMIGTLKPEKSWVAKWQRINSYKPGLYAITVDGILPDEFINKIEQNGRVYYPRDKPFKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.81
4 0.78
5 0.76
6 0.74
7 0.68
8 0.67
9 0.62
10 0.55
11 0.54
12 0.55
13 0.57
14 0.54
15 0.55
16 0.46
17 0.45
18 0.49
19 0.45
20 0.42
21 0.35
22 0.33
23 0.3
24 0.34
25 0.3
26 0.23
27 0.3
28 0.26
29 0.27
30 0.31
31 0.3
32 0.27
33 0.27
34 0.27
35 0.2
36 0.22
37 0.18
38 0.12
39 0.14
40 0.12
41 0.12
42 0.12
43 0.1
44 0.08
45 0.08
46 0.09
47 0.12
48 0.11
49 0.17
50 0.21
51 0.2
52 0.2
53 0.21
54 0.21
55 0.2
56 0.22
57 0.26
58 0.31
59 0.37
60 0.42
61 0.48
62 0.56
63 0.58
64 0.59
65 0.56
66 0.54
67 0.49
68 0.44
69 0.39
70 0.31
71 0.26
72 0.24
73 0.18
74 0.12
75 0.11
76 0.1
77 0.08
78 0.09
79 0.08
80 0.08
81 0.07
82 0.07
83 0.07
84 0.08
85 0.11
86 0.1
87 0.13
88 0.17
89 0.21
90 0.23
91 0.26
92 0.28
93 0.3
94 0.34
95 0.39
96 0.44
97 0.49