Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9LQ19

Protein Details
Accession A0A4Q9LQ19    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
93-113DNGKMFRKIREMKKKNIKYGGBasic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11.333, cyto 8, cyto_mito 5.833, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002685  Glyco_trans_15  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016020  C:membrane  
GO:0000030  F:mannosyltransferase activity  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF01793  Glyco_transf_15  
Amino Acid Sequences MFLLLFTFYFVIYLGKENAVIIVLSKNDELEKILKCLNTFERMFNSKYRYPYVFFNDSEFSEEYKNKIRDVISSTVEFGLLSSEEWGVPGFIDNGKMFRKIREMKKKNIKYGGLLSYRKMCRFYSGFFYRNELVAKYDYYWRIEPDIEFFCEIKYDPFLFVKNTNKKYGFVISVIEIMETVPTLWNAVSDFIEVYDKKYPNYKMKERMKNIKNKDKDGDNYKDDYGNLRFVTDGHGFNGCHFWSNFEIAAFDFFRSKIYSDFFNFLDRKGGFFYERWGDAPIHSIAVSLFLKKNEIHFFGDIGYYHPPVTYCPSFKQNSLCKCDREKSFNYKRKTCLDKLEIKQYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.13
5 0.13
6 0.12
7 0.11
8 0.09
9 0.1
10 0.1
11 0.12
12 0.12
13 0.13
14 0.13
15 0.14
16 0.15
17 0.18
18 0.19
19 0.2
20 0.24
21 0.24
22 0.24
23 0.3
24 0.31
25 0.33
26 0.33
27 0.34
28 0.37
29 0.4
30 0.43
31 0.42
32 0.45
33 0.43
34 0.46
35 0.48
36 0.44
37 0.43
38 0.47
39 0.49
40 0.47
41 0.43
42 0.42
43 0.38
44 0.35
45 0.37
46 0.31
47 0.25
48 0.24
49 0.25
50 0.25
51 0.32
52 0.33
53 0.29
54 0.32
55 0.31
56 0.31
57 0.35
58 0.36
59 0.3
60 0.3
61 0.3
62 0.26
63 0.25
64 0.2
65 0.14
66 0.11
67 0.08
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.06
75 0.06
76 0.06
77 0.07
78 0.07
79 0.09
80 0.1
81 0.13
82 0.14
83 0.19
84 0.19
85 0.21
86 0.3
87 0.36
88 0.46
89 0.55
90 0.6
91 0.65
92 0.76
93 0.81
94 0.8
95 0.79
96 0.7
97 0.63
98 0.63
99 0.6
100 0.56
101 0.49
102 0.43
103 0.43
104 0.44
105 0.42
106 0.39
107 0.31
108 0.3
109 0.31
110 0.32
111 0.32
112 0.35
113 0.36
114 0.34
115 0.38
116 0.33
117 0.32
118 0.31
119 0.22
120 0.18
121 0.16
122 0.16
123 0.14
124 0.18
125 0.18
126 0.2
127 0.2
128 0.19
129 0.2
130 0.2
131 0.19
132 0.18
133 0.18
134 0.16
135 0.16
136 0.15
137 0.13
138 0.13
139 0.13
140 0.1
141 0.1
142 0.1
143 0.1
144 0.11
145 0.12
146 0.13
147 0.17
148 0.26
149 0.32
150 0.35
151 0.39
152 0.39
153 0.39
154 0.39
155 0.38
156 0.3
157 0.21
158 0.19
159 0.14
160 0.14
161 0.13
162 0.11
163 0.08
164 0.06
165 0.06
166 0.05
167 0.04
168 0.03
169 0.03
170 0.04
171 0.04
172 0.04
173 0.04
174 0.05
175 0.05
176 0.05
177 0.05
178 0.06
179 0.08
180 0.08
181 0.11
182 0.17
183 0.17
184 0.17
185 0.24
186 0.28
187 0.35
188 0.43
189 0.48
190 0.51
191 0.61
192 0.7
193 0.71
194 0.77
195 0.76
196 0.78
197 0.8
198 0.79
199 0.75
200 0.7
201 0.67
202 0.62
203 0.6
204 0.58
205 0.55
206 0.49
207 0.46
208 0.42
209 0.39
210 0.34
211 0.32
212 0.26
213 0.23
214 0.2
215 0.17
216 0.16
217 0.15
218 0.2
219 0.18
220 0.17
221 0.15
222 0.17
223 0.17
224 0.18
225 0.21
226 0.16
227 0.15
228 0.14
229 0.16
230 0.15
231 0.17
232 0.17
233 0.14
234 0.14
235 0.12
236 0.15
237 0.13
238 0.11
239 0.11
240 0.1
241 0.12
242 0.13
243 0.13
244 0.13
245 0.14
246 0.18
247 0.2
248 0.23
249 0.22
250 0.27
251 0.27
252 0.25
253 0.3
254 0.26
255 0.25
256 0.24
257 0.26
258 0.21
259 0.21
260 0.25
261 0.22
262 0.23
263 0.23
264 0.23
265 0.22
266 0.2
267 0.23
268 0.19
269 0.15
270 0.14
271 0.13
272 0.11
273 0.15
274 0.15
275 0.15
276 0.17
277 0.16
278 0.19
279 0.2
280 0.26
281 0.27
282 0.3
283 0.3
284 0.29
285 0.29
286 0.27
287 0.27
288 0.22
289 0.18
290 0.18
291 0.15
292 0.15
293 0.15
294 0.14
295 0.15
296 0.22
297 0.26
298 0.27
299 0.31
300 0.38
301 0.4
302 0.44
303 0.51
304 0.52
305 0.56
306 0.61
307 0.61
308 0.6
309 0.65
310 0.7
311 0.68
312 0.68
313 0.67
314 0.69
315 0.75
316 0.77
317 0.79
318 0.78
319 0.77
320 0.78
321 0.79
322 0.75
323 0.74
324 0.75
325 0.75
326 0.74