Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LS28

Protein Details
Accession A0A4Q9LS28   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MRSKGHKNQSKTKKKKNGIPNPYNRIKEHydrophilic
NLS Segment(s)
PositionSequence
5-17GHKNQSKTKKKKN
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MRSKGHKNQSKTKKKKNGIPNPYNRIKEESHLTEDLDLKCIVSICQDNDLEDLKIFFSRSYIYLDYKKLLKLFPKHMSVSKIETLDSEYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.9
4 0.9
5 0.9
6 0.89
7 0.88
8 0.86
9 0.86
10 0.8
11 0.7
12 0.64
13 0.54
14 0.47
15 0.44
16 0.39
17 0.35
18 0.32
19 0.31
20 0.28
21 0.31
22 0.27
23 0.22
24 0.18
25 0.13
26 0.13
27 0.12
28 0.11
29 0.08
30 0.1
31 0.08
32 0.12
33 0.12
34 0.12
35 0.13
36 0.14
37 0.12
38 0.11
39 0.1
40 0.08
41 0.08
42 0.08
43 0.07
44 0.06
45 0.07
46 0.09
47 0.13
48 0.14
49 0.18
50 0.21
51 0.23
52 0.25
53 0.26
54 0.28
55 0.26
56 0.27
57 0.31
58 0.35
59 0.42
60 0.46
61 0.5
62 0.51
63 0.53
64 0.54
65 0.5
66 0.48
67 0.44
68 0.38
69 0.33
70 0.3