Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9M1C3

Protein Details
Accession A0A4Q9M1C3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
14-34ILAICSKKKSKSKGSKPSSPAHydrophilic
NLS Segment(s)
PositionSequence
20-30KKKSKSKGSKP
Subcellular Location(s) extr 22, mito 2, pero 1, E.R. 1, golg 1, cyto_mito 1, mito_nucl 1
Family & Domain DBs
Amino Acid Sequences MKINFALIFSYLFILAICSKKKSKSKGSKPSSPAPPASGASPDASAAPAGAATAEADPAMAAGGSAAPAPPTAGEAPPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.14
4 0.16
5 0.19
6 0.23
7 0.31
8 0.38
9 0.45
10 0.53
11 0.6
12 0.69
13 0.76
14 0.8
15 0.81
16 0.79
17 0.79
18 0.76
19 0.68
20 0.58
21 0.49
22 0.44
23 0.35
24 0.31
25 0.23
26 0.17
27 0.13
28 0.12
29 0.1
30 0.08
31 0.08
32 0.07
33 0.05
34 0.04
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.04
42 0.03
43 0.04
44 0.03
45 0.04
46 0.03
47 0.03
48 0.02
49 0.02
50 0.03
51 0.03
52 0.03
53 0.04
54 0.04
55 0.04
56 0.05
57 0.05
58 0.08
59 0.1