Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9LPK7

Protein Details
Accession A0A4Q9LPK7    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
75-101QYLEEYKKRQEEKRKNDYIKLKRKLGFHydrophilic
NLS Segment(s)
PositionSequence
87-89KRK
96-96K
Subcellular Location(s) nucl 15, cyto_nucl 14.5, cyto 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MNQETQFVIIKNIKPEKVYELFSTYGKILIAYIGIEENSESALVAYEKIKFAKEAIRIMDGYFCDGKYLDVKYWQYLEEYKKRQEEKRKNDYIKLKRKLGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.4
4 0.38
5 0.39
6 0.32
7 0.3
8 0.3
9 0.29
10 0.28
11 0.21
12 0.18
13 0.15
14 0.13
15 0.09
16 0.07
17 0.07
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.03
29 0.04
30 0.04
31 0.05
32 0.06
33 0.06
34 0.07
35 0.08
36 0.09
37 0.08
38 0.09
39 0.14
40 0.16
41 0.18
42 0.18
43 0.19
44 0.19
45 0.19
46 0.2
47 0.15
48 0.15
49 0.13
50 0.12
51 0.11
52 0.1
53 0.11
54 0.12
55 0.14
56 0.12
57 0.17
58 0.19
59 0.2
60 0.21
61 0.21
62 0.2
63 0.24
64 0.31
65 0.34
66 0.39
67 0.44
68 0.51
69 0.57
70 0.63
71 0.69
72 0.73
73 0.74
74 0.78
75 0.82
76 0.8
77 0.83
78 0.85
79 0.84
80 0.84
81 0.83