Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9LWM4

Protein Details
Accession A0A4Q9LWM4    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-41LLKKGDKGYRCRRDGCRRRKSVRGEIVSBasic
129-155AKNAIKKEAEERKKRSKTQREEFFAKYHydrophilic
NLS Segment(s)
PositionSequence
133-145IKKEAEERKKRSK
Subcellular Location(s) mito 20, mito_nucl 12.999, cyto_mito 11.999, cyto_nucl 4.666, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
Amino Acid Sequences MRRGVPSSARVRLLLKKGDKGYRCRRDGCRRRKSVRGEIVSSEISVLSVIIVQKGDTEIAGVTDRVESCSHLPKRASKLRERFEIPEGADIKKFLVESITKAAKESGQEKVKIPRIRITGEWTQEKEDAKNAIKKEAEERKKRSKTQREEFFAKYPELQQVKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.48
3 0.5
4 0.55
5 0.61
6 0.63
7 0.66
8 0.7
9 0.71
10 0.72
11 0.72
12 0.75
13 0.78
14 0.83
15 0.84
16 0.84
17 0.84
18 0.85
19 0.86
20 0.84
21 0.84
22 0.83
23 0.78
24 0.7
25 0.62
26 0.59
27 0.5
28 0.41
29 0.3
30 0.2
31 0.14
32 0.1
33 0.08
34 0.04
35 0.05
36 0.05
37 0.06
38 0.06
39 0.06
40 0.06
41 0.07
42 0.07
43 0.05
44 0.05
45 0.04
46 0.05
47 0.06
48 0.06
49 0.06
50 0.07
51 0.07
52 0.08
53 0.09
54 0.09
55 0.11
56 0.2
57 0.21
58 0.24
59 0.26
60 0.29
61 0.37
62 0.43
63 0.46
64 0.46
65 0.53
66 0.54
67 0.57
68 0.55
69 0.5
70 0.45
71 0.43
72 0.35
73 0.31
74 0.28
75 0.24
76 0.21
77 0.18
78 0.16
79 0.13
80 0.13
81 0.08
82 0.09
83 0.08
84 0.1
85 0.15
86 0.18
87 0.17
88 0.17
89 0.18
90 0.17
91 0.19
92 0.19
93 0.22
94 0.24
95 0.26
96 0.28
97 0.36
98 0.43
99 0.44
100 0.44
101 0.42
102 0.41
103 0.42
104 0.42
105 0.4
106 0.38
107 0.4
108 0.43
109 0.38
110 0.38
111 0.38
112 0.38
113 0.32
114 0.3
115 0.3
116 0.3
117 0.34
118 0.32
119 0.36
120 0.36
121 0.36
122 0.42
123 0.47
124 0.52
125 0.56
126 0.63
127 0.68
128 0.76
129 0.83
130 0.85
131 0.85
132 0.86
133 0.87
134 0.89
135 0.86
136 0.84
137 0.79
138 0.75
139 0.67
140 0.59
141 0.51
142 0.43
143 0.44