Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LQ84

Protein Details
Accession A0A4Q9LQ84    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-26ILEQTNTSRRTRKKNNDQKIDEDWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5cyto_nucl 11.5, cyto 8.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010285  DNA_helicase_pif1-like  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0003678  F:DNA helicase activity  
GO:0006310  P:DNA recombination  
GO:0006281  P:DNA repair  
GO:0000723  P:telomere maintenance  
Pfam View protein in Pfam  
PF05970  PIF1  
Amino Acid Sequences MVILEQTNTSRRTRKKNNDQKIDEDWFDVVVRAILADTNNYVNFIDFKVLNLITGEIKTYNSIDTGIDKEEVAYQTEFLNLLDFPGTPLHVLKLKIDVSIILLQNFVTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.75
3 0.83
4 0.89
5 0.91
6 0.88
7 0.83
8 0.79
9 0.73
10 0.62
11 0.52
12 0.42
13 0.31
14 0.27
15 0.21
16 0.13
17 0.08
18 0.07
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.06
25 0.08
26 0.08
27 0.09
28 0.09
29 0.08
30 0.09
31 0.08
32 0.09
33 0.07
34 0.08
35 0.1
36 0.09
37 0.09
38 0.09
39 0.09
40 0.08
41 0.08
42 0.08
43 0.06
44 0.06
45 0.07
46 0.07
47 0.06
48 0.06
49 0.07
50 0.07
51 0.08
52 0.09
53 0.09
54 0.09
55 0.09
56 0.09
57 0.11
58 0.11
59 0.12
60 0.11
61 0.1
62 0.1
63 0.11
64 0.11
65 0.08
66 0.09
67 0.06
68 0.07
69 0.07
70 0.06
71 0.07
72 0.08
73 0.08
74 0.08
75 0.09
76 0.11
77 0.14
78 0.16
79 0.16
80 0.2
81 0.21
82 0.2
83 0.2
84 0.18
85 0.18
86 0.23
87 0.23
88 0.18
89 0.17