Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PFJ2

Protein Details
Accession A0A4Q9PFJ2    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
30-55LCVPTKFVWKRPKRDTKRDSRSFDREHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 5, plas 3, cyto_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSLSRASRASRRVKLWLHCHALEGCFLFLLCVPTKFVWKRPKRDTKRDSRSFDREGLHHSLLQDRPKGFQLVSLSSGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.66
3 0.66
4 0.63
5 0.56
6 0.55
7 0.48
8 0.41
9 0.34
10 0.27
11 0.19
12 0.12
13 0.11
14 0.09
15 0.08
16 0.1
17 0.09
18 0.08
19 0.1
20 0.11
21 0.18
22 0.19
23 0.26
24 0.34
25 0.41
26 0.49
27 0.58
28 0.69
29 0.71
30 0.81
31 0.82
32 0.83
33 0.86
34 0.87
35 0.84
36 0.8
37 0.78
38 0.71
39 0.67
40 0.58
41 0.48
42 0.44
43 0.43
44 0.37
45 0.31
46 0.28
47 0.29
48 0.31
49 0.35
50 0.35
51 0.3
52 0.32
53 0.33
54 0.35
55 0.28
56 0.29
57 0.28
58 0.27