Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9NAW6

Protein Details
Accession A0A4Q9NAW6    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
153-173TDGGGGKRRKRREHEQGQEDDBasic
NLS Segment(s)
PositionSequence
158-164GKRRKRR
Subcellular Location(s) mito 18, nucl 6.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036280  Multihaem_cyt_sf  
Amino Acid Sequences MGLSELPNGCKIHLMKRRKLIHSTSPTLSTSPSLFVPLQLQPGPKAVVCTSCHRAFPGAKQSQLVQCARCHAPTCAICSRTCNGVPPPSVPPTPKLTMSPVSPASPGSRSPDVRTPPLLSLSFLDANTSPGHLLGSGDRRPALASHTNMAQSTDGGGGKRRKRREHEQGQEDDGRRVPGESEKEAGIVPGCGRVVCRGCSFETPEIDLNTCYDCAGHEPVHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.52
3 0.61
4 0.7
5 0.7
6 0.75
7 0.72
8 0.73
9 0.73
10 0.7
11 0.64
12 0.58
13 0.53
14 0.46
15 0.4
16 0.32
17 0.24
18 0.2
19 0.17
20 0.17
21 0.16
22 0.16
23 0.18
24 0.18
25 0.21
26 0.22
27 0.23
28 0.2
29 0.23
30 0.23
31 0.2
32 0.21
33 0.18
34 0.21
35 0.23
36 0.28
37 0.32
38 0.33
39 0.33
40 0.31
41 0.35
42 0.32
43 0.35
44 0.4
45 0.37
46 0.36
47 0.36
48 0.38
49 0.37
50 0.41
51 0.37
52 0.29
53 0.26
54 0.3
55 0.3
56 0.3
57 0.28
58 0.23
59 0.27
60 0.26
61 0.31
62 0.32
63 0.32
64 0.3
65 0.31
66 0.32
67 0.29
68 0.27
69 0.25
70 0.23
71 0.26
72 0.27
73 0.26
74 0.28
75 0.28
76 0.29
77 0.26
78 0.26
79 0.27
80 0.28
81 0.26
82 0.24
83 0.24
84 0.24
85 0.24
86 0.24
87 0.2
88 0.19
89 0.18
90 0.17
91 0.16
92 0.15
93 0.15
94 0.16
95 0.19
96 0.19
97 0.21
98 0.27
99 0.28
100 0.28
101 0.29
102 0.26
103 0.23
104 0.25
105 0.23
106 0.17
107 0.15
108 0.16
109 0.15
110 0.13
111 0.13
112 0.1
113 0.12
114 0.11
115 0.11
116 0.08
117 0.06
118 0.07
119 0.06
120 0.06
121 0.07
122 0.13
123 0.14
124 0.15
125 0.15
126 0.15
127 0.15
128 0.15
129 0.18
130 0.18
131 0.19
132 0.19
133 0.21
134 0.22
135 0.21
136 0.22
137 0.17
138 0.11
139 0.11
140 0.11
141 0.1
142 0.1
143 0.16
144 0.23
145 0.31
146 0.39
147 0.47
148 0.54
149 0.61
150 0.71
151 0.76
152 0.79
153 0.82
154 0.82
155 0.78
156 0.74
157 0.73
158 0.64
159 0.55
160 0.45
161 0.36
162 0.28
163 0.24
164 0.2
165 0.2
166 0.23
167 0.23
168 0.24
169 0.22
170 0.23
171 0.22
172 0.21
173 0.15
174 0.12
175 0.1
176 0.11
177 0.11
178 0.1
179 0.11
180 0.17
181 0.2
182 0.22
183 0.25
184 0.25
185 0.28
186 0.32
187 0.37
188 0.36
189 0.35
190 0.36
191 0.36
192 0.36
193 0.34
194 0.3
195 0.26
196 0.23
197 0.2
198 0.16
199 0.13
200 0.11
201 0.14
202 0.18