Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2M5A3

Protein Details
Accession E2M5A3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-40MDTDHRKRRRNRTTQSCLNCHTSKRKCDRKRPCQRCIQLGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG mpr:MPER_15625  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MDTDHRKRRRNRTTQSCLNCHTSKRKCDRKRPCQRCIQLGLTGLCVYEIDDPALRDDPTLDETTRLRNRIAELESLVRELR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.89
3 0.84
4 0.77
5 0.73
6 0.65
7 0.6
8 0.61
9 0.58
10 0.6
11 0.64
12 0.71
13 0.74
14 0.81
15 0.87
16 0.87
17 0.91
18 0.9
19 0.87
20 0.87
21 0.82
22 0.77
23 0.72
24 0.63
25 0.54
26 0.48
27 0.4
28 0.31
29 0.25
30 0.19
31 0.13
32 0.1
33 0.08
34 0.06
35 0.06
36 0.07
37 0.08
38 0.08
39 0.1
40 0.12
41 0.11
42 0.1
43 0.1
44 0.11
45 0.14
46 0.16
47 0.14
48 0.15
49 0.16
50 0.26
51 0.31
52 0.31
53 0.28
54 0.28
55 0.31
56 0.35
57 0.36
58 0.3
59 0.28
60 0.31
61 0.31