Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9Q3T6

Protein Details
Accession A0A4Q9Q3T6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
86-114SGILCHSKSTCRRRRPRTRQYPTAGRPASHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, extr 7, mito 4, cyto 2, E.R. 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTSRPTFASVILLDGAIYFICLFILKFESNIVLFTEPLTSILIWRFMLDLQTVNSGNYPSRLPGCCSRPGVLARRFPCLRAYGRFSGILCHSKSTCRRRRPRTRQYPTAGRPASRTAGTPQSRALAQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.06
4 0.06
5 0.04
6 0.04
7 0.04
8 0.05
9 0.04
10 0.06
11 0.09
12 0.09
13 0.1
14 0.1
15 0.12
16 0.12
17 0.13
18 0.12
19 0.1
20 0.09
21 0.09
22 0.1
23 0.08
24 0.09
25 0.09
26 0.07
27 0.08
28 0.09
29 0.1
30 0.09
31 0.09
32 0.09
33 0.08
34 0.09
35 0.08
36 0.08
37 0.07
38 0.1
39 0.1
40 0.1
41 0.1
42 0.1
43 0.1
44 0.1
45 0.1
46 0.08
47 0.11
48 0.12
49 0.14
50 0.19
51 0.22
52 0.26
53 0.27
54 0.27
55 0.27
56 0.3
57 0.36
58 0.36
59 0.4
60 0.36
61 0.42
62 0.41
63 0.39
64 0.37
65 0.34
66 0.32
67 0.29
68 0.34
69 0.3
70 0.32
71 0.32
72 0.3
73 0.28
74 0.29
75 0.29
76 0.23
77 0.24
78 0.22
79 0.28
80 0.38
81 0.45
82 0.51
83 0.57
84 0.67
85 0.75
86 0.86
87 0.9
88 0.93
89 0.93
90 0.93
91 0.92
92 0.91
93 0.9
94 0.84
95 0.83
96 0.75
97 0.65
98 0.59
99 0.54
100 0.49
101 0.39
102 0.36
103 0.31
104 0.37
105 0.39
106 0.37
107 0.35
108 0.34