Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PZH2

Protein Details
Accession A0A4Q9PZH2    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPKPASTAGKKKKRKKGRKETYSSYIYKHydrophilic
NLS Segment(s)
PositionSequence
8-20TAGKKKKRKKGRK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MAPKPASTAGKKKKRKKGRKETYSSYIYKVLKQVHPDTGISNKAMAILNSFVNDIFERIATEASKLASYSKKSTISSREIQTAVRLILPGELAKHAISEGTKSVTKFSSAGAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.92
3 0.92
4 0.93
5 0.94
6 0.94
7 0.93
8 0.9
9 0.86
10 0.83
11 0.73
12 0.65
13 0.61
14 0.51
15 0.44
16 0.41
17 0.4
18 0.36
19 0.39
20 0.39
21 0.37
22 0.37
23 0.35
24 0.32
25 0.3
26 0.28
27 0.22
28 0.19
29 0.15
30 0.14
31 0.14
32 0.12
33 0.1
34 0.09
35 0.09
36 0.09
37 0.09
38 0.07
39 0.08
40 0.08
41 0.07
42 0.06
43 0.06
44 0.05
45 0.06
46 0.07
47 0.06
48 0.06
49 0.07
50 0.07
51 0.07
52 0.07
53 0.09
54 0.12
55 0.15
56 0.18
57 0.21
58 0.24
59 0.26
60 0.3
61 0.34
62 0.36
63 0.39
64 0.38
65 0.38
66 0.35
67 0.34
68 0.32
69 0.28
70 0.22
71 0.17
72 0.15
73 0.11
74 0.11
75 0.11
76 0.1
77 0.09
78 0.09
79 0.1
80 0.09
81 0.09
82 0.09
83 0.1
84 0.1
85 0.11
86 0.12
87 0.15
88 0.18
89 0.18
90 0.21
91 0.21
92 0.23
93 0.21