Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PX48

Protein Details
Accession A0A4Q9PX48    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-37STWPRDGSRRRVTSRRTQRRDHQPRPTGPASHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 11, cyto_nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MPQLCSSTWPRDGSRRRVTSRRTQRRDHQPRPTGPASLPASSRPLCRRTHTCSPGKPHATRTAPSPSPRQAGRAYFPATNAAAVPCISPCMSPKHLQTSRDPGKSVRLTYLAVIHVTAAADPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.67
3 0.69
4 0.74
5 0.77
6 0.78
7 0.81
8 0.82
9 0.79
10 0.78
11 0.81
12 0.84
13 0.88
14 0.86
15 0.85
16 0.83
17 0.81
18 0.8
19 0.72
20 0.63
21 0.52
22 0.51
23 0.43
24 0.36
25 0.32
26 0.25
27 0.28
28 0.27
29 0.32
30 0.28
31 0.29
32 0.31
33 0.36
34 0.4
35 0.44
36 0.53
37 0.56
38 0.58
39 0.58
40 0.63
41 0.65
42 0.66
43 0.59
44 0.53
45 0.53
46 0.49
47 0.44
48 0.41
49 0.39
50 0.36
51 0.37
52 0.38
53 0.32
54 0.33
55 0.33
56 0.33
57 0.29
58 0.29
59 0.29
60 0.29
61 0.28
62 0.25
63 0.25
64 0.24
65 0.21
66 0.18
67 0.16
68 0.11
69 0.09
70 0.09
71 0.09
72 0.06
73 0.07
74 0.07
75 0.08
76 0.1
77 0.16
78 0.19
79 0.23
80 0.27
81 0.36
82 0.41
83 0.43
84 0.47
85 0.51
86 0.57
87 0.56
88 0.54
89 0.45
90 0.5
91 0.52
92 0.48
93 0.41
94 0.34
95 0.32
96 0.32
97 0.34
98 0.26
99 0.21
100 0.19
101 0.15
102 0.14
103 0.13