Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PHC2

Protein Details
Accession A0A4Q9PHC2    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
228-251MTAEREERERKQRERERKEKELDDAcidic
NLS Segment(s)
PositionSequence
198-247RKKVALAEKPTEKAGPAPRPSSKAWGKKREMTAEREERERKQRERERKEK
Subcellular Location(s) nucl 14, mito 11.5, cyto_mito 7
Family & Domain DBs
Amino Acid Sequences MPGTPPIKKQQQLLAQLAAVRQQIREDKERVEWDRAEQEKAEREPRVREEVELLERERAQLEKELAEWQRGEKERGEKERARKPTSGCVETPRSSPEAGPSKCHRDDNNNNNIVDIIPKRKRARTETMWAPAKKSCAECKEKRIACLFSVGRSRARACHACARSKTKCTGGQRADKTPTVVISDDEPPMAPASPSTPRKKVALAEKPTEKAGPAPRPSSKAWGKKREMTAEREERERKQRERERKEKELDDATAPKEADLPFSRRAQREITILKTLRFAMSKIRQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.46
3 0.44
4 0.4
5 0.35
6 0.29
7 0.23
8 0.19
9 0.22
10 0.28
11 0.32
12 0.38
13 0.38
14 0.38
15 0.44
16 0.52
17 0.51
18 0.51
19 0.46
20 0.44
21 0.5
22 0.49
23 0.45
24 0.39
25 0.39
26 0.4
27 0.44
28 0.45
29 0.41
30 0.42
31 0.46
32 0.49
33 0.52
34 0.45
35 0.41
36 0.38
37 0.39
38 0.4
39 0.36
40 0.33
41 0.29
42 0.28
43 0.27
44 0.25
45 0.2
46 0.17
47 0.19
48 0.19
49 0.17
50 0.18
51 0.23
52 0.23
53 0.25
54 0.24
55 0.21
56 0.27
57 0.29
58 0.3
59 0.28
60 0.35
61 0.41
62 0.48
63 0.54
64 0.52
65 0.58
66 0.65
67 0.68
68 0.65
69 0.62
70 0.58
71 0.6
72 0.61
73 0.56
74 0.49
75 0.47
76 0.48
77 0.45
78 0.43
79 0.36
80 0.3
81 0.27
82 0.26
83 0.27
84 0.3
85 0.29
86 0.33
87 0.35
88 0.41
89 0.44
90 0.47
91 0.42
92 0.43
93 0.53
94 0.56
95 0.61
96 0.58
97 0.55
98 0.51
99 0.48
100 0.38
101 0.31
102 0.24
103 0.23
104 0.23
105 0.3
106 0.34
107 0.38
108 0.44
109 0.47
110 0.53
111 0.51
112 0.55
113 0.53
114 0.57
115 0.61
116 0.56
117 0.51
118 0.44
119 0.4
120 0.34
121 0.31
122 0.29
123 0.29
124 0.37
125 0.39
126 0.44
127 0.51
128 0.5
129 0.5
130 0.49
131 0.43
132 0.34
133 0.38
134 0.31
135 0.25
136 0.28
137 0.26
138 0.24
139 0.25
140 0.25
141 0.21
142 0.26
143 0.25
144 0.25
145 0.32
146 0.34
147 0.39
148 0.43
149 0.48
150 0.48
151 0.49
152 0.48
153 0.45
154 0.48
155 0.47
156 0.52
157 0.5
158 0.55
159 0.55
160 0.57
161 0.56
162 0.5
163 0.46
164 0.37
165 0.31
166 0.24
167 0.2
168 0.15
169 0.14
170 0.15
171 0.13
172 0.13
173 0.12
174 0.1
175 0.11
176 0.1
177 0.08
178 0.06
179 0.09
180 0.17
181 0.25
182 0.3
183 0.33
184 0.35
185 0.37
186 0.4
187 0.42
188 0.44
189 0.47
190 0.48
191 0.51
192 0.53
193 0.53
194 0.51
195 0.46
196 0.36
197 0.32
198 0.34
199 0.35
200 0.36
201 0.4
202 0.42
203 0.46
204 0.47
205 0.5
206 0.51
207 0.53
208 0.58
209 0.63
210 0.66
211 0.69
212 0.74
213 0.75
214 0.71
215 0.67
216 0.67
217 0.67
218 0.63
219 0.64
220 0.62
221 0.59
222 0.64
223 0.67
224 0.63
225 0.65
226 0.73
227 0.76
228 0.82
229 0.85
230 0.84
231 0.85
232 0.86
233 0.79
234 0.76
235 0.7
236 0.62
237 0.57
238 0.52
239 0.44
240 0.4
241 0.36
242 0.29
243 0.28
244 0.25
245 0.26
246 0.27
247 0.3
248 0.31
249 0.38
250 0.45
251 0.44
252 0.47
253 0.45
254 0.44
255 0.48
256 0.49
257 0.47
258 0.49
259 0.49
260 0.46
261 0.44
262 0.42
263 0.38
264 0.33
265 0.29
266 0.3