Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9QDG5

Protein Details
Accession A0A4Q9QDG5    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-31INSNKRQQTQARQALRKRKTRDAPQDKHKEQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences INSNKRQQTQARQALRKRKTRDAPQDKHKEQSHQQPRVPRPLLSPTVWPYLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.8
4 0.76
5 0.76
6 0.75
7 0.77
8 0.81
9 0.81
10 0.81
11 0.82
12 0.86
13 0.77
14 0.75
15 0.67
16 0.62
17 0.57
18 0.6
19 0.6
20 0.57
21 0.59
22 0.61
23 0.64
24 0.68
25 0.65
26 0.56
27 0.5
28 0.5
29 0.51
30 0.44
31 0.45
32 0.39