Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9Q272

Protein Details
Accession A0A4Q9Q272    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-43MAKSKNHTNHNQSRKAHRNGIKKPKSHRTRSTKGYRRNNKFALHydrophilic
NLS Segment(s)
PositionSequence
14-52RKAHRNGIKKPKSHRTRSTKGYRRNNKFALVGSRKARAE
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQSRKAHRNGIKKPKSHRTRSTKGYRRNNKFALVGSRKARAEQKAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.77
4 0.74
5 0.75
6 0.76
7 0.82
8 0.79
9 0.75
10 0.77
11 0.78
12 0.79
13 0.78
14 0.78
15 0.76
16 0.75
17 0.78
18 0.81
19 0.79
20 0.8
21 0.82
22 0.83
23 0.82
24 0.84
25 0.78
26 0.71
27 0.64
28 0.57
29 0.57
30 0.52
31 0.5
32 0.45
33 0.48
34 0.45
35 0.47
36 0.5
37 0.45