Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9Q4Z0

Protein Details
Accession A0A4Q9Q4Z0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MRPCHLCSRLARRRTRWVLKMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MRPCHLCSRLARRRTRWVLKMITNLCTWHALLHRTAPLPTYLHEQPPSLRQRSRGASYHVSRRRSHVGTTVQIDCLPRAPHVLPGQQKSPLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.77
4 0.76
5 0.73
6 0.69
7 0.72
8 0.63
9 0.56
10 0.47
11 0.41
12 0.35
13 0.29
14 0.24
15 0.17
16 0.17
17 0.16
18 0.16
19 0.18
20 0.19
21 0.18
22 0.18
23 0.16
24 0.15
25 0.14
26 0.14
27 0.17
28 0.16
29 0.18
30 0.19
31 0.19
32 0.18
33 0.25
34 0.29
35 0.28
36 0.28
37 0.29
38 0.34
39 0.38
40 0.41
41 0.37
42 0.37
43 0.41
44 0.44
45 0.51
46 0.52
47 0.52
48 0.48
49 0.5
50 0.53
51 0.47
52 0.45
53 0.42
54 0.41
55 0.41
56 0.44
57 0.4
58 0.34
59 0.33
60 0.32
61 0.25
62 0.24
63 0.2
64 0.17
65 0.2
66 0.19
67 0.25
68 0.29
69 0.36
70 0.39
71 0.43
72 0.46