Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9NFB2

Protein Details
Accession A0A4Q9NFB2    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
35-59GPWPPRRCPWTRPKVRKRTESGRDEBasic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MRGKSAGLRIKHVQSKIREADVFIFPPTVTLFRPGPWPPRRCPWTRPKVRKRTESGRDEVYEGTFNEWMNLLSSRTRHEGSTLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.58
3 0.56
4 0.55
5 0.47
6 0.42
7 0.41
8 0.37
9 0.33
10 0.24
11 0.21
12 0.15
13 0.16
14 0.15
15 0.13
16 0.1
17 0.12
18 0.12
19 0.12
20 0.18
21 0.2
22 0.28
23 0.35
24 0.39
25 0.39
26 0.48
27 0.52
28 0.51
29 0.57
30 0.58
31 0.6
32 0.67
33 0.75
34 0.76
35 0.82
36 0.86
37 0.86
38 0.84
39 0.83
40 0.82
41 0.77
42 0.71
43 0.65
44 0.58
45 0.51
46 0.44
47 0.35
48 0.27
49 0.21
50 0.19
51 0.16
52 0.14
53 0.13
54 0.13
55 0.12
56 0.12
57 0.12
58 0.12
59 0.14
60 0.16
61 0.2
62 0.25
63 0.26
64 0.24