Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2M0W7

Protein Details
Accession E2M0W7    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-41ITAKKDWREAKRRYKEQDKSBasic
NLS Segment(s)
Subcellular Location(s) nucl 8.5, mito_nucl 8.5, mito 7.5, cyto 6, pero 3
Family & Domain DBs
KEGG mpr:MPER_13338  -  
Amino Acid Sequences FVVGGVKWWQVRGVNGVDAQWITAKKDWREAKRRYKEQDKSAAKESLQRSEDSNTYEKDMDEMRCILYSHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.21
4 0.19
5 0.17
6 0.16
7 0.14
8 0.12
9 0.12
10 0.15
11 0.2
12 0.2
13 0.29
14 0.37
15 0.43
16 0.52
17 0.59
18 0.66
19 0.71
20 0.78
21 0.77
22 0.8
23 0.78
24 0.75
25 0.77
26 0.71
27 0.65
28 0.62
29 0.56
30 0.46
31 0.46
32 0.42
33 0.39
34 0.35
35 0.32
36 0.29
37 0.3
38 0.32
39 0.29
40 0.3
41 0.24
42 0.26
43 0.26
44 0.23
45 0.22
46 0.24
47 0.22
48 0.21
49 0.21
50 0.19
51 0.2