Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V2K7G4

Protein Details
Accession A0A4V2K7G4    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-32AYIGKPPPHVLKKRRQREEQARARELHydrophilic
NLS Segment(s)
PositionSequence
18-21KKRR
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 8
Family & Domain DBs
Amino Acid Sequences MSKVFPAYIGKPPPHVLKKRRQREEQARARELSPAVPDPEPSTPAHSDHADVFGTINRSATRVYRTYAHKRTRSSARSGAEAESGGEEEEQSSECPSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.58
3 0.58
4 0.63
5 0.72
6 0.79
7 0.84
8 0.83
9 0.85
10 0.86
11 0.89
12 0.88
13 0.86
14 0.79
15 0.72
16 0.64
17 0.56
18 0.45
19 0.36
20 0.29
21 0.21
22 0.2
23 0.18
24 0.18
25 0.17
26 0.18
27 0.18
28 0.15
29 0.17
30 0.16
31 0.17
32 0.19
33 0.17
34 0.17
35 0.15
36 0.16
37 0.12
38 0.11
39 0.1
40 0.09
41 0.1
42 0.09
43 0.1
44 0.09
45 0.1
46 0.11
47 0.12
48 0.15
49 0.15
50 0.16
51 0.21
52 0.29
53 0.38
54 0.47
55 0.55
56 0.56
57 0.59
58 0.64
59 0.69
60 0.66
61 0.63
62 0.61
63 0.54
64 0.52
65 0.5
66 0.44
67 0.35
68 0.3
69 0.24
70 0.17
71 0.15
72 0.11
73 0.09
74 0.08
75 0.07
76 0.08
77 0.08
78 0.08