Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9QFR2

Protein Details
Accession A0A4Q9QFR2    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-54PAGKEARPSHSRPRRRRRRSWTRRTSPSSRGRKPRRPLSRPRATRLBasic
NLS Segment(s)
PositionSequence
12-56KEARPSHSRPRRRRRRSWTRRTSPSSRGRKPRRPLSRPRATRLRR
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 8
Family & Domain DBs
Amino Acid Sequences VQSALQSCPAGKEARPSHSRPRRRRRRSWTRRTSPSSRGRKPRRPLSRPRATRLRRGVLLVAASRSASCPFSSLPFLAQWHI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.45
4 0.53
5 0.61
6 0.71
7 0.72
8 0.79
9 0.82
10 0.86
11 0.92
12 0.92
13 0.93
14 0.94
15 0.94
16 0.94
17 0.92
18 0.92
19 0.89
20 0.84
21 0.82
22 0.81
23 0.8
24 0.76
25 0.77
26 0.77
27 0.79
28 0.81
29 0.82
30 0.83
31 0.81
32 0.83
33 0.83
34 0.84
35 0.8
36 0.79
37 0.79
38 0.72
39 0.74
40 0.71
41 0.66
42 0.57
43 0.53
44 0.48
45 0.39
46 0.37
47 0.29
48 0.22
49 0.17
50 0.15
51 0.13
52 0.13
53 0.13
54 0.12
55 0.11
56 0.12
57 0.13
58 0.16
59 0.2
60 0.19
61 0.19
62 0.21