Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9QFK6

Protein Details
Accession A0A4Q9QFK6    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-46GRKLRACRSCSQRKVKCLPSEGDPRCRECVKRSKHCERPEITHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSGSGRKLRACRSCSQRKVKCLPSEGDPRCRECVKRSKHCERPEITATHNPCDNCKRSHVACEWSGAGPCTFCSSARSAASCSLASENSGGSDRTPSFALDPMRPSSSPQTHYFDIVLNKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.8
3 0.78
4 0.79
5 0.83
6 0.82
7 0.8
8 0.74
9 0.67
10 0.63
11 0.66
12 0.62
13 0.63
14 0.58
15 0.54
16 0.53
17 0.54
18 0.5
19 0.47
20 0.52
21 0.52
22 0.59
23 0.65
24 0.71
25 0.76
26 0.8
27 0.8
28 0.74
29 0.71
30 0.65
31 0.58
32 0.52
33 0.49
34 0.44
35 0.38
36 0.37
37 0.3
38 0.29
39 0.33
40 0.32
41 0.27
42 0.28
43 0.31
44 0.29
45 0.34
46 0.33
47 0.31
48 0.28
49 0.28
50 0.26
51 0.21
52 0.2
53 0.16
54 0.13
55 0.09
56 0.08
57 0.1
58 0.09
59 0.09
60 0.11
61 0.13
62 0.16
63 0.18
64 0.19
65 0.17
66 0.18
67 0.2
68 0.18
69 0.17
70 0.14
71 0.13
72 0.13
73 0.12
74 0.1
75 0.09
76 0.1
77 0.09
78 0.08
79 0.13
80 0.12
81 0.14
82 0.14
83 0.14
84 0.14
85 0.19
86 0.22
87 0.21
88 0.24
89 0.26
90 0.29
91 0.29
92 0.31
93 0.36
94 0.39
95 0.41
96 0.43
97 0.45
98 0.43
99 0.45
100 0.42
101 0.37