Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V2K7M7

Protein Details
Accession A0A4V2K7M7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGCRLPSPRRWRVRQVSAMCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MGCRLPSPRRWRVRQVSAMCVHTCVWSTYQVPCSSPVRPLAVARLVLKARALLDAFLCYIALDGSAQAQGSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.77
3 0.75
4 0.69
5 0.66
6 0.55
7 0.47
8 0.38
9 0.29
10 0.25
11 0.18
12 0.15
13 0.14
14 0.15
15 0.16
16 0.19
17 0.19
18 0.19
19 0.21
20 0.22
21 0.2
22 0.21
23 0.2
24 0.18
25 0.18
26 0.18
27 0.17
28 0.17
29 0.18
30 0.17
31 0.19
32 0.18
33 0.17
34 0.17
35 0.15
36 0.14
37 0.14
38 0.13
39 0.1
40 0.1
41 0.11
42 0.11
43 0.1
44 0.09
45 0.07
46 0.07
47 0.06
48 0.06
49 0.05
50 0.05
51 0.06
52 0.07