Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9PHS1

Protein Details
Accession A0A4Q9PHS1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-71TETRAPRRDRPSRIHYRRKLPCWALHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, mito 4, cyto 2, extr 2, vacu 2, mito_nucl 2
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MPPRDGRIKFQHAEVSMATITCTPTILIVVLSCYNLRDRSCVCVIATETRAPRRDRPSRIHYRRKLPCWALPGAFAGIEHLELRDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.31
3 0.23
4 0.22
5 0.19
6 0.13
7 0.13
8 0.1
9 0.1
10 0.07
11 0.06
12 0.07
13 0.07
14 0.06
15 0.05
16 0.07
17 0.07
18 0.07
19 0.07
20 0.08
21 0.09
22 0.12
23 0.12
24 0.14
25 0.14
26 0.18
27 0.19
28 0.2
29 0.17
30 0.16
31 0.17
32 0.18
33 0.18
34 0.17
35 0.18
36 0.22
37 0.27
38 0.28
39 0.34
40 0.4
41 0.48
42 0.52
43 0.57
44 0.63
45 0.69
46 0.77
47 0.81
48 0.79
49 0.81
50 0.83
51 0.81
52 0.81
53 0.75
54 0.7
55 0.64
56 0.61
57 0.51
58 0.43
59 0.39
60 0.3
61 0.24
62 0.19
63 0.15
64 0.11
65 0.12
66 0.11