Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9NZJ6

Protein Details
Accession A0A4Q9NZJ6    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
43-62TGDICKKRCWHYRPAPQQFTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 6, nucl 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MCRRRQVRTVFKRCNHGVTYPDEIVQCYGDNCIFSPNHPPTCTGDICKKRCWHYRPAPQQFTEEKQAYCPNCVKAGYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.64
3 0.56
4 0.49
5 0.43
6 0.45
7 0.36
8 0.35
9 0.29
10 0.26
11 0.23
12 0.2
13 0.16
14 0.09
15 0.1
16 0.08
17 0.09
18 0.08
19 0.1
20 0.1
21 0.1
22 0.18
23 0.21
24 0.24
25 0.24
26 0.25
27 0.26
28 0.31
29 0.31
30 0.26
31 0.3
32 0.37
33 0.39
34 0.44
35 0.45
36 0.48
37 0.57
38 0.59
39 0.6
40 0.62
41 0.7
42 0.75
43 0.8
44 0.79
45 0.71
46 0.73
47 0.67
48 0.61
49 0.59
50 0.51
51 0.41
52 0.39
53 0.45
54 0.4
55 0.41
56 0.41
57 0.35
58 0.36