Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9P8V3

Protein Details
Accession A0A4Q9P8V3    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-45LSSRSPTPPSNKKARKHDTHKPRRHASRDRHQQDDBasic
NLS Segment(s)
PositionSequence
18-65PPSNKKARKHDTHKPRRHASRDRHQQDDPHRHRREGDRARERGRSRDR
Subcellular Location(s) nucl 14, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences AYTHLVLRRSLSSRSPTPPSNKKARKHDTHKPRRHASRDRHQQDDPHRHRREGDRARERGRSRDRDPQLGSAERGQHPDMRRPVLGKTSRPPQNWVDDWLAQEEAELAEDPEANQPPVVDFTQPRPQPSANASRPPRLVPRHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.49
3 0.5
4 0.56
5 0.62
6 0.64
7 0.68
8 0.71
9 0.74
10 0.79
11 0.82
12 0.83
13 0.82
14 0.85
15 0.85
16 0.88
17 0.89
18 0.88
19 0.88
20 0.87
21 0.88
22 0.87
23 0.86
24 0.85
25 0.87
26 0.82
27 0.78
28 0.7
29 0.68
30 0.68
31 0.7
32 0.67
33 0.66
34 0.64
35 0.6
36 0.62
37 0.62
38 0.62
39 0.6
40 0.63
41 0.61
42 0.65
43 0.68
44 0.71
45 0.66
46 0.65
47 0.64
48 0.61
49 0.56
50 0.6
51 0.59
52 0.57
53 0.57
54 0.52
55 0.46
56 0.4
57 0.37
58 0.29
59 0.3
60 0.24
61 0.24
62 0.21
63 0.22
64 0.22
65 0.28
66 0.29
67 0.28
68 0.28
69 0.27
70 0.27
71 0.32
72 0.34
73 0.31
74 0.32
75 0.39
76 0.46
77 0.46
78 0.49
79 0.43
80 0.47
81 0.44
82 0.43
83 0.38
84 0.32
85 0.31
86 0.29
87 0.25
88 0.18
89 0.16
90 0.12
91 0.08
92 0.08
93 0.07
94 0.05
95 0.05
96 0.06
97 0.07
98 0.11
99 0.12
100 0.12
101 0.12
102 0.12
103 0.12
104 0.16
105 0.16
106 0.15
107 0.15
108 0.21
109 0.31
110 0.33
111 0.35
112 0.36
113 0.36
114 0.38
115 0.43
116 0.47
117 0.44
118 0.52
119 0.54
120 0.57
121 0.58
122 0.59
123 0.61