Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PRP5

Protein Details
Accession A0A4Q9PRP5    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
56-86ALRRDRYWKGKITRKPRREKRRMNAMIERMKBasic
NLS Segment(s)
PositionSequence
47-80ERARLGRITALRRDRYWKGKITRKPRREKRRMNA
Subcellular Location(s) mito 13, cyto 7, nucl 5
Family & Domain DBs
Amino Acid Sequences MRACTRIYALHAVGIVLGTGDCIYVCDRRAANASITTADALREKNGERARLGRITALRRDRYWKGKITRKPRREKRRMNAMIERMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.11
3 0.06
4 0.05
5 0.04
6 0.03
7 0.03
8 0.03
9 0.04
10 0.06
11 0.08
12 0.09
13 0.13
14 0.13
15 0.15
16 0.18
17 0.19
18 0.19
19 0.19
20 0.19
21 0.15
22 0.16
23 0.14
24 0.11
25 0.1
26 0.1
27 0.08
28 0.08
29 0.09
30 0.09
31 0.16
32 0.18
33 0.2
34 0.19
35 0.22
36 0.25
37 0.25
38 0.25
39 0.22
40 0.24
41 0.27
42 0.33
43 0.38
44 0.38
45 0.38
46 0.44
47 0.47
48 0.5
49 0.52
50 0.53
51 0.55
52 0.61
53 0.69
54 0.74
55 0.78
56 0.81
57 0.86
58 0.89
59 0.91
60 0.92
61 0.94
62 0.93
63 0.94
64 0.92
65 0.89
66 0.88