Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PTH6

Protein Details
Accession A0A4Q9PTH6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
92-113LMDPRMKTSRRQPCRSRMLLRTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, plas 2
Family & Domain DBs
Amino Acid Sequences MFCMPNPRRHGWQACMVWTGAPTRYLKSTLRRRRPSVANTGTILNFVLSYGFKLTSPSCKRDFGHMVVVPCLRLVTACSGVRVGHWSLSTLLMDPRMKTSRRQPCRSRMLLRTLTCSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.49
3 0.43
4 0.34
5 0.29
6 0.26
7 0.18
8 0.18
9 0.17
10 0.17
11 0.19
12 0.23
13 0.26
14 0.34
15 0.44
16 0.51
17 0.61
18 0.67
19 0.7
20 0.75
21 0.78
22 0.74
23 0.73
24 0.67
25 0.59
26 0.52
27 0.48
28 0.4
29 0.32
30 0.26
31 0.15
32 0.1
33 0.07
34 0.07
35 0.05
36 0.05
37 0.06
38 0.06
39 0.06
40 0.08
41 0.09
42 0.18
43 0.22
44 0.25
45 0.27
46 0.3
47 0.31
48 0.35
49 0.39
50 0.31
51 0.34
52 0.32
53 0.31
54 0.29
55 0.29
56 0.22
57 0.19
58 0.16
59 0.09
60 0.07
61 0.07
62 0.08
63 0.13
64 0.13
65 0.13
66 0.14
67 0.14
68 0.15
69 0.17
70 0.15
71 0.12
72 0.12
73 0.13
74 0.13
75 0.14
76 0.14
77 0.12
78 0.12
79 0.16
80 0.17
81 0.17
82 0.22
83 0.27
84 0.28
85 0.33
86 0.42
87 0.48
88 0.57
89 0.66
90 0.69
91 0.73
92 0.82
93 0.85
94 0.83
95 0.78
96 0.78
97 0.77
98 0.71