Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PM67

Protein Details
Accession A0A4Q9PM67    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSSKRGRKRNDNLPPNRARDVHydrophilic
NLS Segment(s)
PositionSequence
7-8RK
71-71K
73-73K
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Amino Acid Sequences MSSKRGRKRNDNLPPNRARDVQRAFRARRAAHLEALENRVAELEEENNTLRAALSLPPANRPPLGKGPTGKDKPKASGSKSATPSGLLSSLASGGPMPPLSRTESPLSTGSASGHSMSPDPMSSASGLSAPSQTSPPPLDPAGWSDNIFGDKDSDQSLSSNFSLPSTSSHASHNNPFSQIPRSVPNDIFPSAQGFTSSDEKSFGYLPSEGRRSYNYSHPLMSGHPSAQSTLPPSLSSSAGDTNDLAPFLQRRAITEPDGFRTLLNQMQASQNGLQTPAPRMSQSTLLNVVDAPLSEYDLPGGAERRYPRLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.83
3 0.79
4 0.73
5 0.68
6 0.67
7 0.66
8 0.65
9 0.66
10 0.7
11 0.69
12 0.69
13 0.73
14 0.64
15 0.63
16 0.62
17 0.56
18 0.51
19 0.5
20 0.47
21 0.43
22 0.46
23 0.39
24 0.3
25 0.26
26 0.22
27 0.19
28 0.15
29 0.12
30 0.11
31 0.11
32 0.13
33 0.14
34 0.14
35 0.14
36 0.13
37 0.12
38 0.1
39 0.1
40 0.1
41 0.13
42 0.17
43 0.18
44 0.23
45 0.25
46 0.27
47 0.28
48 0.27
49 0.29
50 0.34
51 0.37
52 0.36
53 0.38
54 0.43
55 0.51
56 0.57
57 0.57
58 0.55
59 0.55
60 0.56
61 0.6
62 0.61
63 0.55
64 0.57
65 0.58
66 0.59
67 0.59
68 0.56
69 0.47
70 0.41
71 0.37
72 0.28
73 0.23
74 0.14
75 0.11
76 0.09
77 0.09
78 0.08
79 0.08
80 0.06
81 0.06
82 0.06
83 0.07
84 0.07
85 0.07
86 0.09
87 0.14
88 0.15
89 0.19
90 0.21
91 0.21
92 0.24
93 0.24
94 0.24
95 0.19
96 0.18
97 0.16
98 0.13
99 0.13
100 0.11
101 0.11
102 0.1
103 0.1
104 0.1
105 0.1
106 0.08
107 0.08
108 0.08
109 0.08
110 0.08
111 0.07
112 0.07
113 0.07
114 0.07
115 0.07
116 0.08
117 0.07
118 0.08
119 0.08
120 0.08
121 0.1
122 0.11
123 0.11
124 0.13
125 0.13
126 0.13
127 0.13
128 0.16
129 0.16
130 0.16
131 0.15
132 0.13
133 0.14
134 0.14
135 0.13
136 0.1
137 0.09
138 0.08
139 0.09
140 0.09
141 0.09
142 0.08
143 0.09
144 0.09
145 0.1
146 0.1
147 0.11
148 0.1
149 0.09
150 0.1
151 0.09
152 0.11
153 0.14
154 0.14
155 0.14
156 0.16
157 0.2
158 0.22
159 0.27
160 0.28
161 0.24
162 0.25
163 0.24
164 0.24
165 0.24
166 0.23
167 0.2
168 0.22
169 0.25
170 0.26
171 0.26
172 0.27
173 0.26
174 0.26
175 0.24
176 0.19
177 0.18
178 0.15
179 0.15
180 0.13
181 0.1
182 0.12
183 0.16
184 0.16
185 0.14
186 0.15
187 0.15
188 0.15
189 0.16
190 0.13
191 0.11
192 0.12
193 0.14
194 0.18
195 0.21
196 0.21
197 0.21
198 0.24
199 0.26
200 0.27
201 0.34
202 0.34
203 0.33
204 0.33
205 0.32
206 0.31
207 0.28
208 0.29
209 0.22
210 0.17
211 0.17
212 0.16
213 0.17
214 0.17
215 0.17
216 0.16
217 0.16
218 0.16
219 0.15
220 0.16
221 0.16
222 0.16
223 0.15
224 0.14
225 0.16
226 0.16
227 0.16
228 0.15
229 0.15
230 0.14
231 0.14
232 0.12
233 0.1
234 0.11
235 0.12
236 0.15
237 0.14
238 0.17
239 0.22
240 0.25
241 0.27
242 0.32
243 0.34
244 0.34
245 0.36
246 0.33
247 0.28
248 0.26
249 0.25
250 0.22
251 0.21
252 0.17
253 0.17
254 0.21
255 0.22
256 0.23
257 0.22
258 0.21
259 0.19
260 0.2
261 0.21
262 0.19
263 0.22
264 0.23
265 0.23
266 0.22
267 0.24
268 0.25
269 0.3
270 0.3
271 0.3
272 0.31
273 0.3
274 0.29
275 0.26
276 0.24
277 0.18
278 0.15
279 0.13
280 0.09
281 0.11
282 0.11
283 0.11
284 0.11
285 0.11
286 0.12
287 0.12
288 0.15
289 0.13
290 0.19
291 0.22