Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9P9G8

Protein Details
Accession A0A4Q9P9G8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-36TSSSGGKAAKKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
12-30SGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAPTSSSGGKAAKKKKWSKGKVKDKAQHAVVLDKATYDRILKEVPTFRFISQSILIERLKINGSLARVAIRHLEKEGQIKRIVHHSSQLVYTRATGGGGAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.39
3 0.45
4 0.47
5 0.56
6 0.63
7 0.71
8 0.78
9 0.82
10 0.84
11 0.86
12 0.9
13 0.9
14 0.91
15 0.88
16 0.84
17 0.81
18 0.71
19 0.63
20 0.53
21 0.46
22 0.37
23 0.3
24 0.23
25 0.16
26 0.15
27 0.12
28 0.12
29 0.1
30 0.09
31 0.09
32 0.1
33 0.1
34 0.14
35 0.19
36 0.2
37 0.22
38 0.24
39 0.22
40 0.24
41 0.23
42 0.22
43 0.18
44 0.18
45 0.15
46 0.17
47 0.17
48 0.15
49 0.15
50 0.14
51 0.13
52 0.12
53 0.12
54 0.11
55 0.12
56 0.12
57 0.12
58 0.12
59 0.12
60 0.12
61 0.17
62 0.17
63 0.17
64 0.17
65 0.2
66 0.21
67 0.29
68 0.33
69 0.31
70 0.34
71 0.34
72 0.35
73 0.41
74 0.42
75 0.35
76 0.37
77 0.35
78 0.33
79 0.36
80 0.38
81 0.31
82 0.27
83 0.27
84 0.23
85 0.21
86 0.19